DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd59A and FKH1

DIOPT Version :9

Sequence 1:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:63/195 - (32%)
Similarity:87/195 - (44%) Gaps:41/195 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSD-------IEP--- 60
            |.:||         || .||...:.||:..|          |.:.|..|:.|       |.|   
Yeast   228 DHLHT---------PL-SSSSDVNPIGDPHG----------DTIMMEEDEEDENYTRGGIRPNTY 272

  Fly    61 SSMGGSGAAGGN-------GDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSR 118
            :|...:....||       .|.| ......:|||.||.::||.|||.:|...::|:.|..||...
Yeast   273 TSSSNNAVTNGNVPHIENPSDLS-LDENRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDN 336

  Fly   119 FPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTL-DPLAEDMFD--NGSFLRRRKR 180
            :.:|:....|||||:|||||||..|.|||:..|..|||..|.: |.:..|..:  |...|.:.:|
Yeast   337 YAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRR 401

  Fly   181  180
            Yeast   402  401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 39/88 (44%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 63/195 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1393
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.