DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fd59A and FKH1

Sequence 1:NP_523814.1 Gene:fd59A FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae

Alignment Length:195 Identity:63/196 (32%)
Similarity:87/196 (44%) Gaps:41/196 (21%)


  Fly     6 DPMHTLHDSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSD-------IEP--- 60
            |.:||         || .||...:.||:..|          |.:.|..|:.|       |.|   
Yeast   228 DHLHT---------PL-SSSSDVNPIGDPHG----------DTIMMEEDEEDENYTRGGIRPNTY 272

  Fly    61 SSMGGSGAAGGN-------GDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSR 118
            :|...:....||       .|.| ......:|||.||.::||.|||.:|...::|:.|..||...
Yeast   273 TSSSNNAVTNGNVPHIENPSDLS-LDENRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDN 336

  Fly   119 FPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTL-DPLAEDMFD--NGSFLRRRKR 180
            :.:|:....|||||:|||||||..|.|||:..|..|||..|.: |.:..|..:  |...|.:.:|
Yeast   337 YAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLNKWNAGKLSKIRR 401

  Fly   181  180
            Yeast   402  401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 39/89 (44%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 63/196 (32%)
FHA 67..170 CDD:238017
Forkhead 303..389 CDD:278670 39/86 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000015
OrthoInspector 1 1.000 T133801
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11829
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2114
TreeFam 00.000 Not matched by this tool.
55.080

Return to query results.
Submit another query.