DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fd59A and si:ch211-262e15.1

Sequence 1:NP_523814.1 Gene:fd59A FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_001922856.1 Gene:si:ch211-262e15.1 ZFINID:ZDB-GENE-030131-5310 Length:597 Species:Danio rerio

Alignment Length:216 Identity:77/217 (35%)
Similarity:101/217 (47%) Gaps:24/217 (11%)


  Fly    13 DSVS--LSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIE---PSSMGGSGAAGGN 72
            |:::  :||  :.|..|..|..|  .|.:|.|.|.:....:|....|::   .:|...:......
Zfish   142 DNIAHLMSP--LPSPTGTISAAN--SCPSSPRGAGSSGYRLGRIVPDLQLMNDNSQSENDKETSE 202

  Fly    73 GDGSGSSGGPLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNL 137
            ||......    ||||||..||..||..:|.|:|||:||...|...:|||:.....|||||||||
Zfish   203 GDSPKDDS----KPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNL 263

  Fly   138 SLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPF 202
            |||..||||||....||||:||.:||.:|......:|.:||.|          ..|.....|.|.
Zfish   264 SLNRYFIKVPRSQEEPGKGSFWRIDPSSEGKLVEQAFRKRRPR----------GVPCFRTPLGPL 318

  Fly   203 WIRKPVPLVPVHFNVPNFNGS 223
            ..|. .|..|.|..|.:.:.|
Zfish   319 SSRS-APASPNHSGVLSAHSS 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 48/86 (56%)
si:ch211-262e15.1XP_001922856.1 FHA 17..109 CDD:238017
Forkhead 211..297 CDD:278670 48/86 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2114
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.