DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fd59A and foxb2

Sequence 1:NP_523814.1 Gene:fd59A FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:XP_005162532.1 Gene:foxb2 ZFINID:ZDB-GENE-081104-320 Length:318 Species:Danio rerio

Alignment Length:98 Identity:64/99 (65%)
Similarity:72/99 (73%) Gaps:0/99 (0%)


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            |||||||:|..|||.....|.|.||.|..|||.|||||::....||||:|||||.||||||:||.
Zfish    13 KPPYSYISLTAMAIQSCSEKMLPLSDIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPRR 77

  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYK 182
            |..||||:||.|.|...|||:||||||||||:|
Zfish    78 PDQPGKGSFWALHPDCGDMFENGSFLRRRKRFK 110

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 53/86 (62%)
foxb2XP_005162532.1 FH 13..101 CDD:214627 55/88 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000015
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2114
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.