DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fd59A and CG32006

Sequence 1:NP_523814.1 Gene:fd59A FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_726538.1 Gene:CG32006 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster

Alignment Length:109 Identity:41/110 (37%)
Similarity:62/110 (56%) Gaps:17/110 (15%)


  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149
            |||::|..:|.||:||  :.::||..:|.:|.::|.:::.: ..|.|||||||||:.||....||
  Fly   146 KPPFNYSHIIGMAMLQ--NGRITLQQLCSWIEAKFAFFRVR-KKWNNSIRHNLSLHHCFRNRKRE 207

  Fly   150 PGNPGKGNFWTL--DPLAEDMFDNGSFLRRRKRYKRA--PTMQR 189
              ..|||.:|.|  ||...|        |:|.|.::.  ||..:
  Fly   208 --ERGKGGYWELGVDPKKCD--------RKRIRNRKIFHPTQNQ 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 36/88 (41%)
CG32006NP_726538.1 FH 146..217 CDD:294049 32/76 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000015
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11829
RoundUp 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.