DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fd59A and Foxl2

Sequence 1:NP_523814.1 Gene:fd59A FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_036150.1 Gene:Foxl2 MGIID:1349428 Length:375 Species:Mus musculus

Alignment Length:174 Identity:82/175 (47%)
Similarity:98/175 (56%) Gaps:41/175 (23%)


  Fly    59 EPSSMGG------SGAAGGNGDGS----GSSGG-------PLVKPPYSYIALITMAILQSPHKKL 106
            ||....|      ||.|....:.|    |..||       |..||||||:|||.|||.:|..|:|
Mouse     7 EPEDTAGTLLAPESGRAVKEAEASPPSPGKGGGTTPEKPDPAQKPPYSYVALIAMAIRESAEKRL 71

  Fly   107 TLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDN 171
            |||||..:|:::||:|:.....||||||||||||:||||||||.|...|||:|||||..||||:.
Mouse    72 TLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEK 136

  Fly   172 GSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPVHF 215
            |:: |||:|.||                 ||  |.|    |.||
Mouse   137 GNY-RRRRRMKR-----------------PF--RPP----PAHF 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 57/86 (66%)
Foxl2NP_036150.1 FH 50..138 CDD:214627 58/88 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1270467at2759
OrthoFinder 1 1.000 FOG0000015
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.