DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: fd59A and FOXD1

Sequence 1:NP_523814.1 Gene:fd59A FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_004463.1 Gene:FOXD1 HGNCID:3802 Length:465 Species:Homo sapiens

Alignment Length:395 Identity:148/396 (37%)
Similarity:177/396 (45%) Gaps:129/396 (33%)


  Fly    13 DSVSLSPPLIKSSRGGSSIGNGIGCSASSRTAAADAMSMGCDDSDIEPSSMGGSGAAGGNGDGSG 77
            |.:.|:||     .|||....|                         |:...|:||.||.|.|..
Human    75 DDILLAPP-----AGGSPAPPG-------------------------PAPAAGAGAGGGGGGGGA 109

  Fly    78 SSGG--------PLVKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIR 134
            ..||        |||||||||||||||||||||.|:||||.||:||..|||||::||||||||||
Human   110 GGGGSAGSGAKNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIR 174

  Fly   135 HNLSLNDCFIKVPREPGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSF------- 192
            |||||||||:|:|||||||||||:|||||.:.||||||||||||||:||.|.:...:.       
Human   175 HNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLLPPNAAAAESLLL 239

  Fly   193 -----------PAVFGTLSPFWIRKPVPLVPVH------------FNVPNFNGSREFDVVHNPAD 234
                       ||....|.|     |.|..|.|            ..:|.:         ..|:.
Human   240 RGAGAAGGAGDPAAAAALFP-----PAPPPPPHAYGYGPYGCGYGLQLPPY---------APPSA 290

  Fly   235 VFDSALRADKKFNFFANAEASFYQGSQ--------SGDKFDRLPFMNRGR--GADVLDALPHSSG 289
            :|.:|..        |.|.|:|:..|.        :..:..|..|..|..  ||.:...||.|:.
Human   291 LFAAAAA--------AAAAAAFHPHSPPPPPPPHGAAAELARTAFGYRPHPLGAALPGPLPASAA 347

  Fly   290 SGGGVGGGS--------ESSRGSKYKSPYAFDVATVASAAG-------------IPGHRDYAERL 333
            ..||.|..:        ||..|.......|...|..|:||.             .||        
Human   348 KAGGPGASALARSPFSIESIIGGSLGPAAAAAAAAQAAAAAQASPSPSPVAAPPAPG-------- 404

  Fly   334 SAGGG 338
            |:|||
Human   405 SSGGG 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 72/86 (84%)
FOXD1NP_004463.1 Forkhead 125..211 CDD:278670 72/86 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000015
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11829
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.