DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stl and ADAMTS10

Sequence 1:NP_001097423.1 Gene:stl FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_112219.3 Gene:ADAMTS10 HGNCID:13201 Length:1103 Species:Homo sapiens

Alignment Length:1141 Identity:258/1142 (23%)
Similarity:376/1142 (33%) Gaps:395/1142 (35%)


  Fly   134 DGNG------PLPPEEEEQEAGEDVEARLQLQQSPQLIDDAFIFIRRTENGTQF---VEHSPQLL 189
            |.||      |.||..:.:..|...|:||              |.:.....|.|   :..|.:||
Human    48 DHNGALLAFSPPPPRRQRRGTGATAESRL--------------FYKVASPSTHFLLNLTRSSRLL 98

  Fly   190 ----------------KRLER--CFY--------RSPAAALDLCEPGNVRGVFQQNGSDLVIHPL 228
                            :|..|  |.|        .|...|:..|  |.:.|:...:..:.:|.||
Human    99 AGHVSVEYWTREGLAWQRAARPHCLYAGHLQGQASSSHVAISTC--GGLHGLIVADEEEYLIEPL 161

  Fly   229 ---------PARFGTGTHVLYQ------ARVDKSGGGYSEASSR------RTASPLDSQLQFEPD 272
                     |..  :|.||:|:      ..:|.:.|...|...:      ||..|          
Human   162 HGGPKGSRSPEE--SGPHVVYKRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKP---------- 214

  Fly   273 AEEFNEPRRRLRAQSQLQSPLRLRFQPRHHHPHQHHQQRRRRYIGDAPRSRWSDIPEELFIETAI 337
                 .|.|.|..:::       |.||                  ...||    :..|.::||.:
Human   215 -----PPARPLGNETE-------RGQP------------------GLKRS----VSRERYVETLV 245

  Fly   338 FVDSDLYAHMQKNFPTNTESKVVSFLLAMINGVQLLYHHPTLGRRINFVLKRLEIWKSWDPPGLV 402
            ..|..:.|:       :....|..::||::|.|..|:...:||..:|.::.|| |..:.|.|.|.
Human   246 VADKMMVAY-------HGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNILVTRL-ILLTEDQPTLE 302

  Fly   403 RSRDVENYLNSFCKWQEKL-------NPFSDADPLHYDHALVLTGLDLVTYDKGKANSQVVGMAT 460
            .:......|:||||||:.:       |...:....::|.|:::|..|:..|......:  :|:|.
Human   303 ITHHAGKSLDSFCKWQKSIVNHSGHGNAIPENGVANHDTAVLITRYDICIYKNKPCGT--LGLAP 365

  Fly   461 VKGMCTSIYSCTINEAKHFESVFVVAHEIGHNLGMRHDAKEISC-----DPTMHIMSPKLGSGKV 520
            |.|||....||::||.....:.|.:||||||..||.||....||     ||.      ||.:..:
Human   366 VGGMCERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPA------KLMAAHI 424

  Fly   521 T-------WSKCSRTYLEDFLMDPQAECLFD---RDSFAGPWDHTAGGRLPGERFNANQQCMLRF 575
            |       ||.|||.|:..||......||.:   |..|..|   |..   ||:.::|::||..:.
Human   425 TMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYP---TVA---PGQAYDADEQCRFQH 483

  Fly   576 GKNFMQASTQSKM-EICRDLHC--RQDGLPWTSHPALEGTECGPNM----WCRGGTCEARSSKQG 633
            |..    |.|.|. |:|.:|.|  :.:.....|.||.|||.|..:.    ||....|....|:  
Human   484 GVK----SRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFGSR-- 542

  Fly   634 SYSALKSWPPEHIPEATHEKIIRHEPNRIPPLLHDYNPMDNELPGSPSNWGEWSEPSACESGCLY 698
                     ||.:..|                                 ||.|:....|...|  
Human   543 ---------PEGVDGA---------------------------------WGPWTPWGDCSRTC-- 563

  Fly   699 GQSRRLLEGSTGLRTLNRSCLNFP------SRCIGRDRRFVTCNTPQCHKVPVQTINDFATQVCM 757
                     ..|:.:.:|.| :.|      ..|:|..||..:|||..|   |..: .||....|.
Human   564 ---------GGGVSSSSRHC-DSPRPTIGGKYCLGERRRHRSCNTDDC---PPGS-QDFREVQCS 614

  Fly   758 QARKSDP---------ELTGEGQQLPSTLDASCKIFCRTR-TNGTKSRRWTFPDGTTCKAKQHNP 812
            :. .|.|         ...|.|.:       :|.:.|... .|....|.....|||.|:     |
Human   615 EF-DSIPFRGKFYKWKTYRGGGVK-------ACSLTCLAEGFNFYTERAAAVVDGTPCR-----P 666

  Fly   813 EDITYCISGRCERFSCDNSTSNFFKM--------DSSFCEA------------------------ 845
            :.:..|:||.|:...||....:..:.        |.|.||.                        
Human   667 DTVDICVSGECKHVGCDRVLGSDLREDKCRVCGGDGSACETIEGVFSPASPGAGYEDVVWIPKGS 731

  Fly   846 ---------RSVRPTRDSSDQESRQQTNRQRYAERQEGKPQKNHY------------ENEVAKRP 889
                     .|:.......||||       ...|...|.||.:..            .::|....
Human   732 VHIFIQDLNLSLSHLALKGDQES-------LLLEGLPGTPQPHRLPLAGTTFQLRQGPDQVQSLE 789

  Fly   890 SYGQGN------------------HINAPAS-----PYKRRNYHKPYPPEIPRPPPPASASLI-A 930
            :.|..|                  ..|||.:     ||   ::|  |.|........|..|.: |
Human   790 ALGPINASLIVMVLARTELPALRYRFNAPIARDSLPPY---SWH--YAPWTKCSAQCAGGSQVQA 849

  Fly   931 LDRSSSSESEWVAHPGC--HSN-------CMTDS------KGVQGVTSRL--TGVESIQLCSYRI 978
            ::..:..:|..||...|  ||.       |.|:.      .|...:.||.  .||.|      |.
Human   850 VECRNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPDWVVGNWSLCSRSCDAGVRS------RS 908

  Fly   979 QPCERLQTAAE---YAEQTCARYRQKVRGLSGHGAQIS---ASID--EPDRSCRVGCQDEFIKYR 1035
            ..|:|..:|||   ..:..|.:.|..|.. :.||....   |::|  |...||..|     :::|
Human   909 VVCQRRVSAAEEKALDDSACPQPRPPVLE-ACHGPTCPPEWAALDWSECTPSCGPG-----LRHR 967

  Fly  1036 YYLVNG--RNGHFPPGTRCSPVGK----RYCVYGRC 1065
            ..|...  .....|| ..|||..|    ..|...||
Human   968 VVLCKSADHRATLPP-AHCSPAAKPPATMRCNLRRC 1002

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848 24/122 (20%)
ZnMc_ADAMTS_like 331..543 CDD:239801 70/231 (30%)
Reprolysin 332..545 CDD:279729 70/235 (30%)
TSP1 683..741 CDD:214559 17/64 (27%)
ADAMTS10NP_112219.3 Pep_M12B_propep 73..179 CDD:279848 25/124 (20%)
Reprolysin 239..457 CDD:279729 70/234 (30%)
ZnMc_ADAMTS_like 239..454 CDD:239801 70/231 (30%)
TSP1 550..602 CDD:214559 17/67 (25%)
Spacer 706..828 18/132 (14%)
ADAM_spacer1 706..818 CDD:283607 15/119 (13%)
TSP1 829..885 CDD:214559 14/58 (24%)
TSP1 952..1003 CDD:214559 16/58 (28%)
TSP1 1010..1054 CDD:214559
PLAC 1069..1100 CDD:285849
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13723
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.