DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stl and AdamTS-A

Sequence 1:NP_001097423.1 Gene:stl FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_996218.1 Gene:AdamTS-A FlyBaseID:FBgn0286071 Length:1688 Species:Drosophila melanogaster

Alignment Length:1085 Identity:225/1086 (21%)
Similarity:377/1086 (35%) Gaps:325/1086 (30%)


  Fly   153 EARLQLQQSPQLI-DDAFIFIRRTENGTQFVEH-SPQLLKRLER----CFYRS-------PAAAL 204
            :..|.|:|....: :.:...||..:.|.   || .|:.....|:    |||..       ...::
  Fly   304 QLHLVLRQDASFVHNHSMTHIRILKEGE---EHPGPETEAEAEQRHLGCFYSGYVEDDPHSMVSV 365

  Fly   205 DLCEPGNVRGVFQQNGSDLVIHPLPARFGTGTHVLYQARVDKSGGGYSEASSRRTASPLDSQLQF 269
            .||  |.:.|..:.:...|:|.|:...  :...||:  ||.:.    |:.::|...|      :|
  Fly   366 SLC--GGMTGYIKTSFGALLIQPVNRT--SSDEVLH--RVFRK----SQRNARHAVS------KF 414

  Fly   270 EPDAEEFNEPRRRLRAQSQLQSPLRLRFQPRHHHPHQHHQQRRRRYIGDAPRSRWSDIPEELF-I 333
            |...::|.....:::.:.|.....:|..:.||                      ::|:..::: :
  Fly   415 ELGLDDFMSKLEQVQEEEQKSKSRKLNRKKRH----------------------YADVDNQVYTL 457

  Fly   334 ETAIFVDSDLYAHMQKNFPTNTESKVVSFLLAMINGVQLLYHHPTLGRRINFVLKRLEIWKSWDP 398
            |..|.||:.:     |.|........:..|:::::.:   :...::|..|..:|.||....:.:.
  Fly   458 EVLIAVDNSM-----KQFHGEDLQPYILILMSIVSSI---FADASIGNSIRILLVRLISLPNIND 514

  Fly   399 PGLVRSRDVENYLNSFCKWQEKLNPFSDADPLHYDHALVLTGLDLVTYDKGKANSQVVGMATVKG 463
                ::......|..||:       |.:......|.|:::|...:.....||. ..::|:|.:..
  Fly   515 ----QTHSSNEMLKHFCQ-------FINQSGYERDTAMLITREPICGSVPGKI-CHMLGLAELGT 567

  Fly   464 MCTSIYSCTINEAKHFESVFVVAHEIGHNLGMRHDAKEISCDP---------TMHIMSPKLG--S 517
            :|:| .||:|.:.....:.|.:|||:||.|.|.||..: .|.|         .:||||..:|  .
  Fly   568 VCSS-SSCSIVQDTGLPTAFTMAHELGHILNMNHDDDD-KCMPYVTRQNNNKVLHIMSSVMGIHM 630

  Fly   518 GKVTWSKCSRTYLEDFLMDPQAECLFDRDSFAGPWDHTAGG--RLPGERFNANQQCMLRFGKNFM 580
            ...:||||||.::.:||......||   ::..|.  |...|  |||||.::.:.||.|.||.:|.
  Fly   631 HPWSWSKCSRHFVSEFLEKTDKSCL---ETSVGA--HIPYGTERLPGEIYSLDAQCQLSFGNDFG 690

  Fly   581 QASTQSKMEICRDL-----------HCRQDGLPWTSHPALEGTECGPN-MWCRGGTCEARSSKQG 633
            ...|.   |.|:.|           .|....|||.     :||.||.: .||:.|.|.:..    
  Fly   691 YCPTD---EECKRLWCNRTSGNSNEQCASSNLPWA-----DGTPCGSSGHWCQRGKCVSNK---- 743

  Fly   634 SYSALKSWPPEHIPEATHEKIIRHEPNRIPPLLHDYNPMDNELPGSPSNWGEWSEPSACESGCLY 698
                                             |.|....|      ..||.|:..:.|...|  
  Fly   744 ---------------------------------HGYGRQVN------GGWGPWTPFTPCSLTC-- 767

  Fly   699 GQSRRLLEGSTGLRTLNRSCLNFP------SRCIGRDRRFVTCNTPQCHKVPVQTINDFATQVC- 756
                     ..|::...|.| |.|      ..|.|..:::.:|||.||   |..:: |...|.| 
  Fly   768 ---------GGGVQESRREC-NQPVPENGGKYCTGSRKKYRSCNTHQC---PPGSM-DPREQQCY 818

  Fly   757 -MQARKSD-PELTGEGQQLPSTLDASCKIFCRTRTNGT----KSRRWTFPDGTTCKAKQHNPEDI 815
             |..|..: |.:..:.:.:|.....:||:|||.....|    ||   ...|||:|..     :..
  Fly   819 AMNGRNMNIPGVNPDTKWVPKYEKDACKLFCRMDMKVTYFMLKS---MVTDGTSCAV-----DSF 875

  Fly   816 TYCISGRCERFSCDNSTSNFFKMDS-SFCEARSVRPTRDSSDQESRQQTNRQRYAERQEGKPQKN 879
            ..|::|.|....|||..::..|:|. ..||.|:     |:..:.:...............:|.|.
  Fly   876 DKCVNGICRPAGCDNELNSIAKLDKCGVCEGRN-----DTCHEVTGNLLVSNLLGLNDGNEPNKT 935

  Fly   880 HYENEVAKRPSYGQGNHINAPASPYKRRNYHKPYPPEIPRPPPPASASLIALDRSSSSESEWVAH 944
            .|                               |...||:     .||.|.:.:....:..::..
  Fly   936 LY-------------------------------YVTRIPK-----GASNIIITQRGYPDQNFIVL 964

  Fly   945 PGCHSNCMTDSKGVQ---------GVTSRLTGVES------------------IQLCSYRIQPCE 982
            .....|.:.:.|.::         |||.:.||..|                  :|:.|..:.|.:
  Fly   965 TDDRDNELLNGKFLKTYPLKFVYAGVTMQYTGSSSVVEQVNTTYSWKLSRDLIVQIISLDVSPSK 1029

  Fly   983 RLQTAAEYAEQTCARYRQKVRGLSGHGAQISASIDE-PDRSCRVGCQDEFIKYRY---------Y 1037
            |..|..                     ...|.:||: ||....|..      ||:         .
  Fly  1030 RQDTVL---------------------LSYSYTIDKPPDYEAEVEI------YRWEMQAPSNCDS 1067

  Fly  1038 LVNGRNGHFP------PGTRCSPVGKRYCVYGRCLEFGD----DDLPLDKTHISL-------GQL 1085
            |..||:...|      .|.:.:|   ::|......:..|    .|..|:.|..|:       |:|
  Fly  1068 LCEGRSHRLPACISTTQGVKVAP---QFCDKSAMPKIDDRACNTDCRLNLTVTSISECSAACGEL 1129

  Fly  1086 RTRRKRSSISNDLFNITEIFIKPSHSDISAENIEFTQPIHVSADE 1130
            .||.|..:......|:.    :.:..|:|...::|....|....|
  Fly  1130 GTREKTYACVQTFTNMQ----RSNIVDMSYCKLKFDVAYHEECRE 1170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848 21/97 (22%)
ZnMc_ADAMTS_like 331..543 CDD:239801 55/224 (25%)
Reprolysin 332..545 CDD:279729 55/225 (24%)
TSP1 683..741 CDD:214559 17/64 (27%)
AdamTS-ANP_996218.1 TSP1 1172..1229 CDD:214559
GON 1495..1687 CDD:285848
Pep_M12B_propep 286..394 CDD:279848 20/97 (21%)
ZnMc_ADAMTS_like 455..655 CDD:239801 54/222 (24%)
Reprolysin 457..655 CDD:279729 54/220 (25%)
Salp15 <696..745 CDD:288931 16/91 (18%)
TSP1 754..806 CDD:214559 17/67 (25%)
ADAM_spacer1 937..1042 CDD:283607 21/162 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3538
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13723
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.