DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stl and C36B7.5

Sequence 1:NP_001097423.1 Gene:stl FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:NP_509195.1 Gene:C36B7.5 WormBaseID:WBGene00016468 Length:1148 Species:Caenorhabditis elegans

Alignment Length:867 Identity:163/868 (19%)
Similarity:250/868 (29%) Gaps:326/868 (38%)


  Fly   505 DPTMHIMSPKLGSGKVT----WSKCSRTYLEDFLMDPQAEC---LFDRDSFAG------------ 550
            |...|:..|...:..|.    ||:||            |.|   |..|....|            
 Worm   292 DDCYHVAPPGQAAPPVVEWTEWSECS------------ASCGISLRTRQCLGGITCIGPSTIPCQ 344

  Fly   551 -----------PWDHTAGGRLPGERFNANQQCMLRFGKNFMQASTQSKMEICRDLHCRQDGLP-- 602
                       ||.........|| ...|:.|  :.|:|....|.:  :|.|:.|      ||  
 Worm   345 VPECAVWTLWSPWSLCTATCGVGE-IQRNRVC--QTGRNCDGPSVE--VEACKAL------LPCP 398

  Fly   603 -WTSHPALE--GTECGPNM-----WCRGG-----------TCEARS----SKQGSY-SALKSWPP 643
             |:|..:..  |..||.::     .|:.|           ||:.|.    |..|.: ...|....
 Worm   399 TWSSWMSWTGCGNSCGKSIERRSRICQNGLLCPGPATEERTCDKRPCPHWSNWGQWEKCSKECGA 463

  Fly   644 EH------------IPEATHEKIIRHEPNRIPPLLHDYNPMDNELPGSPSNWGEWSEPSACESGC 696
            .|            ...|:.|||                 :.|:.| .| .|.:|:..:.|:..|
 Worm   464 GHTYRNRECIDGVSCEGASEEKI-----------------LCNQQP-CP-EWSQWTAWTVCDERC 509

  Fly   697 LYGQSRRLLEGSTGLRTLNRSCLNFPSR--CIGRDRRFVTCNTPQCHK-------VPVQTINDFA 752
                      |...:|..||.|:|..:.  |.|..:..::|....|.|       ....|.....
 Worm   510 ----------GEESIRLRNRKCMNAENNNACDGPAQDQMSCPYRDCPKWEEWGEWADCSTTCGQG 564

  Fly   753 TQVCMQARKSDPELTGEGQQLPSTLDASCKIFCRTRTNGTKSRRWTFPDGTTCKAKQHNPEDITY 817
            ||..::...|..|.:|.|:::.....|||..:          ..||...|.:....|...|....
 Worm   565 TQKRLRKCDSGNECSGPGEEMRFCQIASCPYW----------GDWTPWSGCSVSCGQGVCERTRK 619

  Fly   818 CISGR------CERFSCDNSTSNFFKMDSSFCEARSVRPTRDSSDQESRQQTNRQRYAERQEG-- 874
            ||:..      .|....|:|.......::....|:::...|.::  |:|....|....|.|.|  
 Worm   620 CITDEFLQLPTLEELERDDSLEKHEAKEALIARAKTISKYRRTN--ETRLSPFRPLSPEPQLGGT 682

  Fly   875 --KPQKNHYENEVAK-------------RPSYGQGNHINAPASPYKRRNYHKPYPPEIPRPPP-- 922
              .|:   .|.:|..             .|..|.||      ....:||.......:.|.|||  
 Worm   683 CDGPE---METKVCDAGPCCVWNRWTEWSPCIGCGN------EGISKRNRVCSMEGQSPAPPPIS 738

  Fly   923 ------------------------PASASLIALDRSSSSESEWV---AHPGCHSNCMTDSKGVQG 960
                                    |..:.::.::..........   |.|.||  |..|:...:.
 Worm   739 FQVRRHRTYVTASLGQGPIGPNILPGMSPIVPVEIHRGKRQVLFGIQATPKCH--CPGDTFQTRP 801

  Fly   961 VTSRLTGVESIQLCSY----------RIQP--------CER----------------------LQ 985
            ...:....:.:..|.:          |.:|        |:|                      .|
 Worm   802 CLEQNACQDPVGKCEWSEWGEWCGCMRCRPGKEVRRRFCDRSPIGRGGPMRPDSTCDCGNGDDSQ 866

  Fly   986 TAAEYAEQTC------------------ARYRQKVRGLSGHGAQISA------SIDEPDRSCRVG 1026
            ..:...||||                  ||.||..||.:|.....:|      |.:...|.....
 Worm   867 ERSCPMEQTCYGNGIGTGRFNNAASMQDARERQNFRGRTGSFYNTAAPQRDRTSYNSNRRPSHSR 931

  Fly  1027 CQDEFIKY-----RYYLVNGR---------------NGHFP----------PGTRC----SPVGK 1057
            .|||::..     |..|.:|:               ...||          ..:||    :...|
 Worm   932 SQDEYVPIDSVIGRVQLRSGKEPQSYNKKDNAEAFETTEFPYKVCHWSKWSEWSRCHDNSTRERK 996

  Fly  1058 RYCVYGR---------CLEFGDDDLPLDKT-HISLGQLRTRRKRSSISNDLFNITEIFIKPSHSD 1112
            |:||..:         ||....::.|.:.| .|......|.|:   |.|:|..:.|       .|
 Worm   997 RFCVGEKGSELVSNCECLGKPHEEEPCNATGFIEQSNEETDRE---IENNLDKLLE-------ED 1051

  Fly  1113 ISAENIEFTQPIHVSADELSSK 1134
            .:..::|    :|...:||.||
 Worm  1052 NAGGDVE----LHKKKEELKSK 1069

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801 11/45 (24%)
Reprolysin 332..545 CDD:279729 11/47 (23%)
TSP1 683..741 CDD:214559 14/60 (23%)
C36B7.5NP_509195.1 TSP1 309..348 CDD:214559 9/51 (18%)
TSP1 351..398 CDD:214559 14/58 (24%)
TSP1 400..446 CDD:214559 10/46 (22%)
TSP1 448..494 CDD:214559 10/64 (16%)
TSP1 548..594 CDD:214559 10/46 (22%)
TSP1 596..>621 CDD:214559 6/35 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.