DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: stl and adamtsl3

Sequence 1:NP_001097423.1 Gene:stl FlyBaseID:FBgn0086408 Length:1136 Species:Drosophila melanogaster
Sequence 2:XP_003198947.4 Gene:adamtsl3 ZFINID:ZDB-GENE-121030-8 Length:1760 Species:Danio rerio

Alignment Length:401 Identity:90/402 (22%)
Similarity:141/402 (35%) Gaps:94/402 (23%)


  Fly   683 WGEWSEPSACESGCLYGQSRRLLEGSTGLRTLNRSCLNFPSRCIGRDRRFVTCNTPQCHKVPVQT 747
            ||.||:   |...|..|.|..|           |.||| ...|.||:.|:.||:...|   |:::
Zfish    81 WGTWSD---CSRTCGGGASYSL-----------RRCLN-GGNCEGRNIRYRTCSNTDC---PLES 127

  Fly   748 INDFATQVCMQARKSDPELTGEGQQ-LPSTLD--ASCKIFCRTRTNGTKSRRWTFP---DGTTCK 806
             .||..|.|  :..:|.:..|:..: :|.|.|  :.|.:.|:.|..|....  ..|   |||.||
Zfish   128 -GDFRAQQC--SAHNDIKYQGQTYEWIPVTYDPVSPCALRCQARGKGQVVE--LAPKVLDGTRCK 187

  Fly   807 AKQHNPEDITYCISGRCERFSCDNSTSNFFKMDS-SFCEARSVRPTRDSSDQESRQQTNRQRYAE 870
            |     :.:..||||.|:...||....:..|.|: ..|          :.|..:.:....|....
Zfish   188 A-----DSLDMCISGICQEVGCDRQLGSNAKEDNCGVC----------AGDGSTCRLIRGQALPH 237

  Fly   871 RQEGKPQKNHYENEVAKRPSYGQGNHINAPASPYKRRNYHKPYPPEIPRPPPPASASLIALDRSS 935
            ....:|.|.     |.:.|...:|..|.|..                     |....:.|..::|
Zfish   238 VSPEEPIKT-----VIEVPMGSRGLRITAKG---------------------PDMIVIEAHGQNS 276

  Fly   936 SSESEWVAHPGCHS---NCMTDSKGVQGVTSRLTGVESIQLCSYRIQPCERLQTAAEYAEQTCAR 997
            ..|....:..|.||   |.:...:|.:..|.|..|..:... :.:::......|..::......|
Zfish   277 RREEVHFSSSGSHSLGNNTVEFQRGAERQTLRCYGPLTADF-TVKVKYAGPKDTVIQFMFYQPIR 340

  Fly   998 YRQKVRGL------SGHGAQISASIDEPDRSCRVGCQDEFIKYRYYLVNGRNGHFPPGTRCSPVG 1056
            |:.:....      .|.|.|::::          .|.|  |:|...:.......||..|:.:|..
Zfish   341 YQWRETDFFPCSVTCGGGYQLNSA----------DCVD--IRYNRSVAEHLCHSFPENTKPTPKL 393

  Fly  1057 KRYCVYGRCLE 1067
            |. |....|.|
Zfish   394 KE-CNMEPCPE 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
stlNP_001097423.1 Pep_M12B_propep <155..239 CDD:279848
ZnMc_ADAMTS_like 331..543 CDD:239801
Reprolysin 332..545 CDD:279729
TSP1 683..741 CDD:214559 20/58 (34%)
adamtsl3XP_003198947.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.