DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: blw and ATPsynbetaL

Sequence 1:NP_726243.1 Gene:blw FlyBaseID:FBgn0011211 Length:552 Species:Drosophila melanogaster
Sequence 2:NP_648836.2 Gene:ATPsynbetaL FlyBaseID:FBgn0036568 Length:622 Species:Drosophila melanogaster

Alignment Length:522 Identity:123/523 (24%)
Similarity:210/523 (40%) Gaps:91/523 (17%)


  Fly    22 QVACKAAYPAASLAARKLHVASTQRSAEISNILEERILGVAPKAD-----LEETGR---VLSIGD 78
            |..||.   .|.|..:|         .|..:..||:      |:|     ||..||   :.::..
  Fly    65 QEVCKT---DAELVKKK---------DEAEDECEEK------KSDGGGKKLESKGRKGVIHAVIG 111

  Fly    79 GIARVY-------GLNNIQADEMVEFSSGLKGMAL----NLEPDNVGVVVFGNDKLIKQGDIVKR 132
            .:..||       .||.:|..:     :.:..:.|    :|..:.|..|...:.:.:::|..|..
  Fly   112 PVIDVYFEEEVPEVLNALQVQD-----APIANLVLEVFHHLGNNIVRCVAMDSTEGLRRGQPVLD 171

  Fly   133 TGAIVDVPVGDELLGRVVDALGNAIDGKGAINTKDRFRVGIKAPGIIPRVSVR-EPMQTGIKAVD 196
            ||..:.|.||..:|||:::.:|:.||.:|.:.:.....:..:||.:.. :||: |.:.||||.:|
  Fly   172 TGYPIRVAVGKAVLGRILNVVGDPIDDRGEVKSDFYSFIHNEAPELTD-LSVKPEILVTGIKVID 235

  Fly   197 SLVPIGRGQRELIIGDRQTGKTALAIDTIINQKRFNEAQDESKKLYCIYVAIGQKRSTVAQIVKR 261
            .|.|..:|.:..:.|....|||.|.::.|.|..:       |...|.::|..|::......:...
  Fly   236 LLAPYVKGGKIGLFGGAGVGKTVLIMELINNIAK-------SHGGYSVFVGAGERTREGNDLYHE 293

  Fly   262 LTDSGAMGYS------VIVSATASDAAPLQYLAPYSGCAMGEYFRD-KGKHALIIYDDLSKQAVA 319
            :.:|..:...      |:|....::....:.....:|..:.||||| .|:..|:..|::.:...|
  Fly   294 MIESKVISLEDDSSKVVLVFGQMNEPPGARSRVVLTGLTIAEYFRDVDGQDVLLFIDNIFRFTQA 358

  Fly   320 YRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSPAMGGGSLTALPVIETQAGDVSAYIPTNV 384
            ..::|.||.|.|....|...:......:.||..    :...||:|::..:...|.|:|...|...
  Fly   359 GSEVSALLGRIPSAVGYQPTLGTDMGTMQERIT----STRNGSITSVQAVYVPADDLSDPAPAAT 419

  Fly   385 ISITDGQIFLETELFYKGIRPAINVGLSVSR------VGSAAQTKAMKQVAGSMKLELAQYREVA 443
            .|..|....|...:...||.||::...|.||      ||     :....||.:::..|..|:.:.
  Fly   420 FSHLDATTVLSRPIAELGIYPAVDPLDSSSRILDPDVVG-----EEHYNVARAVQKTLQAYKSLQ 479

  Fly   444 -AFAQFGSD-LDAATQQLLNRGVRLTELLKQGQYVPMAIEDQVAVIYCGVRGHLDKMDPAKITKF 506
             ..|..|.| |....:..:.|..::...|.|    |.    |||.|:.|        .|.|:...
  Fly   480 DIIAILGMDELSEEDKLTVARARKMQRFLSQ----PF----QVAEIFTG--------HPGKLVPV 528

  Fly   507 EK 508
            ||
  Fly   529 EK 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
blwNP_726243.1 PRK09281 46..552 CDD:236448 117/499 (23%)
ATP-synt_ab_N 68..134 CDD:280947 15/80 (19%)
F1_ATPase_alpha 136..417 CDD:238552 73/295 (25%)
ATP-synt_ab_C 426..520 CDD:278722 21/86 (24%)
ATPsynbetaLNP_648836.2 PRK09280 103..568 CDD:236447 108/467 (23%)
ATP-synt_ab_N 106..173 CDD:280947 12/72 (17%)
F1-ATPase_beta 175..454 CDD:238553 72/291 (25%)
ATP-synt_ab_C 462..571 CDD:278722 21/86 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83110148
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.