DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and Cnga1

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_445949.1 Gene:Cnga1 RGDID:621815 Length:683 Species:Rattus norvegicus

Alignment Length:440 Identity:215/441 (49%)
Similarity:300/441 (68%) Gaps:6/441 (1%)


  Fly   572 VFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRT 636
            |.||:|.:.|.|...:::..:||:.:||.|..|.|:....:..|...||:||.:||.|:....||
  Rat   148 VIDPSGNMYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRT 212

  Fly   637 GYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFN-SILRSFRLVKIYRFWAFMD 700
            ||||.|:|..|.|||...|..:..|.:|.|.::|.|.||...|:| ..:|..||::|.|.:.|..
  Rat   213 GYLEQGLLVKDKLKLIEKYKANLQFKLDVLSVIPTDLLYFKFGWNYPEIRLNRLLRISRMFEFFQ 277

  Fly   701 RTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY---HDSESADVVKQYLQ 762
            |||..|||||:||.:.|:.|:::|.|||.|:|:.|.|..|||:..|||   :|.|...:.::|:.
  Rat   278 RTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYPDVNDPEFGRLARKYVY 342

  Fly   763 SYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDG 827
            |.||.||.|||||:.|.|....|||||::..|.|:::|||::|::.:::::::|||.|||:::|.
  Rat   343 SLYWSTLTLTTIGETPPPVLDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDA 407

  Fly   828 VKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQ 892
            :|.||..|.|...::.:|||||||||..:|..||...:..|||||:|||||||||||||:|.||.
  Rat   408 IKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFA 472

  Fly   893 NTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGE 957
            :.|||.|.||||:|:|.::|||||||:||::|:||||:..|:|.||||:|.|....|..||||||
  Rat   473 DCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGE 537

  Fly   958 ISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLE 1005
            |||||:  ..|||||||:::|:||||||.|||.|:.:.|.|||.|:..||
  Rat   538 ISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLE 587

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
Cnga1NP_445949.1 Ion_trans 178..398 CDD:278921 92/220 (42%)
Crp 464..>620 CDD:223736 75/125 (60%)
CAP_ED 470..586 CDD:237999 69/116 (59%)
CLZ 586..656 CDD:293134 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.