DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and Hcn1

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_445827.1 Gene:Hcn1 RGDID:620688 Length:910 Species:Rattus norvegicus

Alignment Length:941 Identity:215/942 (23%)
Similarity:349/942 (37%) Gaps:273/942 (29%)


  Fly   508 PSQGGPGGP-------GPPHGGHPHHPHHGGA-----GSGGGSGPGSHGGQPHHQKPRRT----- 555
            ||:....||       |.|.||......||.:     ..|||..|.  |.....:.|||.     
  Rat    22 PSKAPATGPAAADKRLGTPPGGGAAGKEHGNSVCFKVDGGGGEEPA--GSFEDAEGPRRQYGFMQ 84

  Fly   556 -------------------ASQRI------RAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNF 595
                               .||:.      |..||.   .::..|.....:||.:::.:..:.|.
  Rat    85 RQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAG---FWIIHPYSDFRFYWDLIMLIMMVGNL 146

  Fly   596 WVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYL-EDG---VLQTDALKLRTHYM 656
            .:|.....|  ...:|...|...:..||.::|:|::.:||||.: ||.   :|....:|:  :|:
  Rat   147 VIIPVGITF--FTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKM--NYL 207

  Fly   657 NSTIFYIDCLCLLPLDFLYL------------------SIGFNSILRSFRLVKIYRFWAFMDRTE 703
            .|. |.:|.:..:|:|:::|                  .:.|..||...||:::.|...::.:.|
  Rat   208 KSW-FVVDFISSIPVDYIFLIVEKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWE 271

  Fly   704 R--HTNY---PNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWV-----YHDSESADVVK 758
            .  |..|   ..:.|...||..:|::.||:|||..::.....|....||     .:||..    |
  Rat   272 EIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWG----K 332

  Fly   759 QYLQSYYWCTLALTTIG-DLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQ 822
            ||..:.:.....:..|| ....|.|..:....:|.::.|...:|..:||...::.|:.::|:::|
  Rat   333 QYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQ 397

  Fly   823 AKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTL-K 886
            .|...|:.||...::|..::.|:..::::.: ..|..|||..:|.|.|.|:.|| :|.:...| .
  Rat   398 EKYKQVEQYMSFHKLPADMRQKIHDYYEHRY-QGKIFDEENILSELNDPLREEI-VNFNCRKLVA 460

  Fly   887 RVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKA 951
            .:.:|.|.:..|:..::.:||..:|.|||||.|:|.|||:||.:..|...|:..:.|.:  .|..
  Rat   461 TMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEM--KLTD 523

  Fly   952 GSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKR----- 1011
            |||||||.:|..|    |||||||:..|..|:.||..:..:||:|||..|...|::|:.|     
  Rat   524 GSYFGEICLLTKG----RRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIG 584

  Fly  1012 ------LEKYKK--------------------------APLEKVKYFNVVAMG------------ 1032
                  |:|::|                          ..:..:.|..:.|:.            
  Rat   585 KKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIPPINYPQMTALNCTSSTTTPTSRM 649

  Fly  1033 RCQSTP-------------------------GLVESCGRTSLEEMWLPP--------------AT 1058
            |.||.|                         .::..|..|:  .:..||              .|
  Rat   650 RTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYTT--AVCSPPIQSPLATRTFHYASPT 712

  Fly  1059 AGASSLMH------------------HHQALQQQHQASQQQPHRQESTQTSSQTHGYSPRSYADR 1105
            |...|||.                  ..|..|||.|...|||.:|:..|...|            
  Rat   713 ASQLSLMQQPQPQLQQSQVQQTQTQTQQQQQQQQPQPQPQQPQQQQQQQQQQQ------------ 765

  Fly  1106 LARATDSPRSVSPSAHGSEERPRSRTTSHHSIRPQSQPSHTGHICDSSSQLECYGAGVGGAGGGT 1170
              :.....:...|...||       :|..:.:...:|..|..|:...                 .
  Rat   766 --QQQQQQQQQQPQTPGS-------STPKNEVHKSTQALHNTHLTRE-----------------V 804

  Fly  1171 TPLLGSHEVLEDEIKRLRERLHTVESENQALNTKLSQQQWDLENRLAEIEMQICGVSSTS----- 1230
            .||..|...|..|:..:..|.|....|:                 ||.|...:..|.||.     
  Rat   805 RPLSASQPSLPHEVSTMISRPHPTVGES-----------------LASIPQPVATVHSTGLQAGS 852

  Fly  1231 -SVDPENETEELERNRESIIXHGSVLPHQAI 1260
             |..|:..|  |.|...|    |::.|::.:
  Rat   853 RSTVPQRVT--LFRQMSS----GAIPPNRGV 877

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
Hcn1NP_445827.1 Intrinsically disordered. {ECO:0000305} 1..82 18/62 (29%)
Ion_trans_N 87..129 CDD:285597 6/45 (13%)
Ion_trans 149..394 CDD:278921 60/254 (24%)
Selectivity filter. {ECO:0000250|UniProtKB:O60741} 347..351 2/4 (50%)
Crp 458..>593 CDD:223736 53/141 (38%)
CAP_ED 464..572 CDD:237999 48/114 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3446
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.