DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and CNGC4

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001332114.1 Gene:CNGC4 AraportID:AT5G54250 Length:694 Species:Arabidopsis thaliana

Alignment Length:514 Identity:97/515 (19%)
Similarity:182/515 (35%) Gaps:155/515 (30%)


  Fly   572 VFDPAGRLCYYWSMV----------VSMAFLYNF-------------WVIIYRFAFQEINRRTIA 613
            :.||..:....|:.|          |...|||..             |:.:           |:.
plant    79 ILDPRSKWVREWNKVFLLVCATGLFVDPLFLYTLSVSDTCMCLLVDGWLAL-----------TVT 132

  Fly   614 IWFCLDYLSDFLYLIDILFHFR------------TGYLEDGVLQTDALKLRTHYMNSTIFYIDCL 666
               .|..::|.|:|.:|...|:            .|....|.....:.::...|:....|:.|..
plant   133 ---ALRSMTDLLHLWNIWIQFKIARRWPYPGGDSDGDTNKGGGTRGSTRVAPPYVKKNGFFFDLF 194

  Fly   667 CLLPLDFLYLSIGFNSILR--SFRLV--------------KIYRFWAFMDRTERHTNYPNLFRST 715
            .:|||..:.|.:...|:|:  |..||              |||       .:.||     |.|:.
plant   195 VILPLPQVVLWVVIPSLLKRGSVTLVVSVLLVTFLFQYLPKIY-------HSIRH-----LRRNA 247

  Fly   716 ALIHYLLVIFHW----------------NGCLYHI------------------------------ 734
            .|..|:.....|                ..|.|.:                              
plant   248 TLSGYIFGTVWWGIALNMIAYFVAAHAAGACWYLLGVQRSAKCLKEQCENTIGCDLRMLSCKEPV 312

  Fly   735 ----------------------------IHKNNGFGSRNWVYHDSESADVVKQYLQSYYWCTLAL 771
                                        |:.|..:|:..|......|...:::.|...:|..:.|
plant   313 YYGTTVMVLDRARLAWAQNHQARSVCLDINTNYTYGAYQWTIQLVSSESRLEKILFPIFWGLMTL 377

  Fly   772 TTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRR 836
            :|.|:|.......|.||.|:.|..||:|...::|::...:.:.::.::....|:..::.:|:.|.
plant   378 STFGNLESTTEWSEVVFNIIVLTSGLLLVTMLIGNIKVFLHATTSKKQAMHLKMRNIEWWMKKRH 442

  Fly   837 VPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCE 901
            :|...:.:|..:....|...:..||...|..||:.|:.:|..::.||.:::|.:||:.:...|..
plant   443 LPIGFRQRVRNYERQRWAAMRGVDECEMVQNLPEGLRRDIKYHLCLDLVRQVPLFQHMDDLVLEN 507

  Fly   902 LVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRL---QVVADNGKTVMASLKAGSYFGE 957
            :..|::.::|:.|:.|.::|:..:.|..|.||.|   |::.|..|: ...|..|::.|:
plant   508 ICDRVKSLIFTKGETIQKEGDAVQRMLFVVRGHLQSSQLLRDGVKS-CCMLGPGNFSGD 565



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.