DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and DND1

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_197045.1 Gene:DND1 AraportID:AT5G15410 Length:726 Species:Arabidopsis thaliana

Alignment Length:652 Identity:128/653 (20%)
Similarity:224/653 (34%) Gaps:197/653 (30%)


  Fly   430 RSTGRGSQDNTLAGGGATSLAMGGHNQYGGNYCNGTDRYPRSRS------QQQG----HHNAAQQ 484
            ::||.....|....||.:|             .:|:|..|...|      .|.|    |..:..|
plant    22 QTTGIDENSNLQINGGDSS-------------SSGSDETPVLSSVECYACTQVGVPAFHSTSCDQ 73

  Fly   485 AHHPYQLQHSASTVSHHPHAHGPPSQGGPGGPGPPHGGHPHHPHHGGAGSGGGSGPGSHGGQPHH 549
            ||.|                                        ...|.:|....|...|..|: 
plant    74 AHAP----------------------------------------EWRASAGSSLVPIQEGSVPN- 97

  Fly   550 QKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMA----------FLYNFWVIIYRFAF 604
              |.||..:|::.....     |.||..:....|:..:.:|          |.|..         
plant    98 --PARTRFRRLKGPFGE-----VLDPRSKRVQRWNRALLLARGMALAVDPLFFYAL--------- 146

  Fly   605 QEINRRT-----------IAIWFCLDYLSDFLYLIDILFHFRTGYLED-------GVLQTDALKL 651
             .|.|.|           .|:...|....|.::|..:...||..|:..       |.|..|...:
plant   147 -SIGRTTGPACLYMDGAFAAVVTVLRTCLDAVHLWHVWLQFRLAYVSRESLVVGCGKLVWDPRAI 210

  Fly   652 RTHYMNS-TIFYIDCLCLLPLDFLYLSIGFNSILRSFR----------------LVKIYRFWAFM 699
            .:||..| |.|:.|.:.:||:......:....::|..:                |.|||.....|
plant   211 ASHYARSLTGFWFDVIVILPVPQAVFWLVVPKLIREEKVKLIMTILLLIFLFQFLPKIYHCICLM 275

  Fly   700 DRTERHTNYPNLFR------STALIHYLLVIFHWNGCLY-------------------------- 732
            .|.::.|.|  :|.      :..||.|.:......||.|                          
plant   276 RRMQKVTGY--IFGTIWWGFALNLIAYFIASHVAGGCWYVLAIQRVASCIRQQCMRTGNCNLSLA 338

  Fly   733 --------------------------HIIHK-----NNG---FGSRNWVYHDSESADVVKQYLQS 763
                                      .:::|     :||   :|...|......|..:..:.|..
plant   339 CKEEVCYQFVSPTSTVGYPCLSGNLTSVVNKPMCLDSNGPFRYGIYRWALPVISSNSLAVKILYP 403

  Fly   764 YYWCTLALTTIGDLPKPRSKG-EYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDG 827
            .:|..:.|:|..:..:|.|.. |.:|.|:.:|.||:||..::|::...:.:|.|.:::.|.:...
plant   404 IFWGLMTLSTFANDLEPTSNWLEVIFSIVMVLSGLLLFTLLIGNIQVFLHAVMAKKRKMQIRCRD 468

  Fly   828 VKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQ 892
            ::.:|:.|::|:.|:.:|.::....|......||...:..||..|:.:|...:..|.:.:|.:|:
plant   469 MEWWMKRRQLPSRLRQRVRRFERQRWNALGGEDELELIHDLPPGLRRDIKRYLCFDLINKVPLFR 533

  Fly   893 NTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMA--SLKAGSYF 955
            ..:...|..:..|.:|.:||..:.|.|:|:..:.|..:.|||::.:....|.|:|  :|:.|.|.
plant   534 GMDDLILDNICDRAKPRVFSKDEKIIREGDPVQRMIFIMRGRVKRIQSLSKGVLATSTLEPGGYL 598

  Fly   956 GE 957
            |:
plant   599 GD 600

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
DND1NP_197045.1 Crp 525..>664 CDD:223736 21/77 (27%)
CAP_ED 531..641 CDD:237999 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.