DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and CNGC18

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_196991.1 Gene:CNGC18 AraportID:AT5G14870 Length:706 Species:Arabidopsis thaliana

Alignment Length:560 Identity:133/561 (24%)
Similarity:221/561 (39%) Gaps:132/561 (24%)


  Fly   570 HFVFDPAGRLCYYWSMV-----VSMAFL--YNFWV----------IIYRFAFQEINRRTIAIWFC 617
            |.:.||...:..||:.|     :...||  :.|:|          |....|......||:|    
plant    38 HQILDPDSNIVTYWNHVFLITSILALFLDPFYFYVPYVGGPACLSIDISLAATVTFFRTVA---- 98

  Fly   618 LDYLSDFLYLIDILFHFRTGYLE-------DGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLY 675
                 |..:|:.|...|||.::.       .|.|..|:.::...|: .|.|.||...:|||..|.
plant    99 -----DIFHLLHIFMKFRTAFVARSSRVFGRGELVMDSREIAMRYL-KTDFLIDVAAMLPLPQLV 157

  Fly   676 LSIGF-----------NSIL----------RSFRLV----KIYRFWAFMDRTERHTNYPNLFRST 715
            :.:..           ||.|          |||.:.    :|.:...|:.:|.......||....
plant   158 IWLVIPAATNGTANHANSTLALIVLVQYIPRSFIIFPLNQRIIKTTGFIAKTAWAGAAYNLLLYI 222

  Fly   716 ALIH------YLLVIFHWNGCLYHIIHKNNGF------------------GSRNW------VYH- 749
            ...|      ||..|.....|..::..|:|..                  ..:.|      :.| 
plant   223 LASHVLGAMWYLSSIGRQFSCWSNVCKKDNALRVLDCLPSFLDCKSLEQPERQYWQNVTQVLSHC 287

  Fly   750 DSESA--------------------DVVKQYLQSYYWCTLALTTIG-DLPKPRSKGEYVFVILQL 793
            |:.|:                    |.|.:||...:|....|::.| ::......||.:|.|...
plant   288 DATSSTTNFKFGMFAEAFTTQVATTDFVSKYLYCLWWGLRNLSSYGQNITTSVYLGETLFCITIC 352

  Fly   794 LFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKC 858
            :|||:||..::|::.:.:.|:|...:|::.|....:.:||.|::|..||.:|.::..|.||..:.
plant   353 IFGLILFTLLIGNMQSSLQSMSVRVEEWRVKRRDTEEWMRHRQLPPELQERVRRFVQYKWLATRG 417

  Fly   859 SDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEV 923
            .|||..:..||..|:.||..::.|..::||..|...:...|..:...|...|.:.|.||.|:|:.
plant   418 VDEESILHSLPTDLRREIQRHLCLSLVRRVPFFSQMDDQLLDAICGCLVSSLSTAGTYIFREGDP 482

  Fly   924 GKEMYIVNRGRLQVVADNGKTV----MASLKAGSYFGE---------ISILNMGTAGNRRTASVR 975
            ..||..|.||:::....||...    ..:|:.|.:.||         .|.||:.::    |.|||
plant   483 VNEMLFVIRGQIESSTTNGGRSGFFNSTTLRPGDFCGEELLTWALMPNSTLNLPSS----TRSVR 543

  Fly   976 SVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKY 1015
            ::...:.|.||.:|:..|..::.    ||:|..::...:|
plant   544 ALSEVEAFALSAEDLKFVAHQFK----RLQSKKLQHAFRY 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
CNGC18NP_196991.1 Ion_trans 92..378 CDD:278921 62/296 (21%)
Crp 443..>579 CDD:223736 37/144 (26%)
CAP_ED 449..580 CDD:237999 36/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.