DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and CNGC13

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001319839.1 Gene:CNGC13 AraportID:AT4G01010 Length:696 Species:Arabidopsis thaliana

Alignment Length:691 Identity:143/692 (21%)
Similarity:266/692 (38%) Gaps:192/692 (28%)


  Fly   540 PGSHGGQPHHQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWV--IIYRF 602
            |.|.|.   |.|.|.:.|     :|..:|  .:.:|.|.....|:.:...|.:....:  :.:..
plant    46 PLSFGS---HNKKRDSNS-----STTTQK--NIINPQGSFLQNWNKIFLFASVIALAIDPLFFYI 100

  Fly   603 AFQEINRRTIAIWFCLDYLS-------DFLYLIDILFHFRTGYLED-------GVLQTDALKLRT 653
            ...:..|..:.:...|:..:       |..|:|.|:|.|||.|:..       |.|..|...:..
plant   101 PIVDGERHCLNLHRNLEIAASVLRTFIDAFYIIHIVFQFRTAYISPSSRVFGRGELVDDPKAIAI 165

  Fly   654 HYMNSTIFYIDCLCLLPL---------------------DFLYLSIGFNSILRSFRLVKIYRFWA 697
            .|: |:.|.||.|.:|||                     |:| :::.|...:.  |:::||..:.
plant   166 KYL-SSYFIIDLLSILPLPQLVVLAVIPNVNKPVSLITKDYL-ITVIFTQYIP--RILRIYPLYT 226

  Fly   698 FMDRTERHTNYPNLFRSTA-------LIHYLLVIFHWNGCLYHIIH------------------- 736
            .:.||.      .:...||       |..|:|. .|..|.|:::|.                   
plant   227 EVTRTS------GIVTETAWAGAAWNLSLYMLA-SHVFGALWYLISVEREDRCWREACEKIPEVC 284

  Fly   737 -------------KNN--------------------GFGSRNWVYHDS------ESADVVKQYLQ 762
                         :|:                    .||    ::.|:      ||.|..|::..
plant   285 NFRFLYCDGNSSVRNDFLTTSCPFINPDDITNSTVFNFG----IFTDALKSGIVESDDFWKKFFY 345

  Fly   763 SYYWCTLALTTIG-DLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLD 826
            .::|....|:.:| :|...:..||.:|.:...:.||:|||.::|::...:.|.:...:|.:.:..
plant   346 CFWWGLRNLSALGQNLNTSKFVGEIIFAVSICISGLVLFALLIGNMQKYLESTTVREEEMRVRKR 410

  Fly   827 GVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIF 891
            ..:.:|..|.:|:.|:.::.::..|.|...:..:||..:..||..|:.:|..:..||.||:|.:|
plant   411 DAEQWMSHRMLPDDLRKRIRRYEQYKWQETRGVEEENLLRNLPKDLRRDIKRHFCLDLLKKVPLF 475

  Fly   892 QNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTV----MASLKAG 952
            :..:...|..:..:|:|||::...|..|:|:..:||..|.||:|.....||...    ...||..
plant   476 EIMDEQLLDAVCDKLKPVLYTENSYAIREGDPVEEMLFVMRGKLMSATTNGGRTGFFNAVYLKPS 540

  Fly   953 SYFGEISI---LNMGTAGN--RRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRL 1012
            .:.||..:   |:..::.:  ..|.:|:::...:.|.|:..|:..|..::.    ||.|   |:|
plant   541 DFCGEDLLTWALDPQSSSHFPISTRTVQALTEVEAFALAADDLKLVASQFR----RLHS---KQL 598

  Fly  1013 EKYKKAPLEKVKYFNVVAMGRCQSTPGLVESCGRTSLEEMWLPPATAGASSLMHHHQALQQQH-- 1075
            :       ...::::|                       .|   .|.|||.:    ||..::|  
plant   599 Q-------HTFRFYSV-----------------------QW---RTWGASFI----QAAWRRHCR 626

  Fly  1076 ----QASQQQPHRQESTQTSSQTHGYSPRS-----YADRLA 1107
                ::..::..|..:..|..:.:..|..|     ||.|.|
plant   627 RKLARSLTEEEDRFRNAITKRERNAASSSSLVATLYASRFA 667



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.