DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and CNGC11

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_182167.2 Gene:CNGC11 AraportID:AT2G46440 Length:621 Species:Arabidopsis thaliana

Alignment Length:524 Identity:111/525 (21%)
Similarity:213/525 (41%) Gaps:103/525 (20%)


  Fly   586 VVSMA----FLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRT--------GY 638
            ||::|    ||:...:...||.| ..::..:|:...:....|..|:|.|:::..|        ..
plant    49 VVALAIDPLFLFIPLIDSQRFCF-TFDKTLVAVVCVIRTFIDTFYVIHIIYYLITETIAPRSQAS 112

  Fly   639 LEDGVLQTDALKLRTHYMNSTIFYIDCLCLLP------LDFLYLSIGFNS-------ILRSF--R 688
            |...::......|:|..:..  |.:|.:.:||      |..:.||....|       ||..:  |
plant   113 LRGEIVVHSKATLKTRLLFH--FIVDIISVLPIPQVVVLTLIPLSASLVSERILKWIILSQYVPR 175

  Fly   689 LVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGC-----LYHIIHKNNGF------- 741
            ::::|..  :.:.|..........|..|.:::.|.:.|...|     |..|..|:..:       
plant   176 IIRMYPL--YKEVTRAFGTVAESKRVGAALNFFLYMLHSYVCGAFWYLSSIERKSTCWRAACART 238

  Fly   742 ---------------GSRN------------------------WVYHDS--------ESADVVKQ 759
                           ||.|                        .:|.|:        :..|..::
plant   239 SDCNLTVTDLLCKRAGSDNIRFLNTSCPLIDPAQITNSTDFDFGMYIDALKSGVLEVKPKDFPRK 303

  Fly   760 YLQSYYWCTLALTTIG-DLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQA 823
            ::..::|....::.:| :|....|.||..|.|:..:.||:|||.::|:|...:.|.:....|.:.
plant   304 FVYCFWWGLRNISALGQNLETSNSAGEIFFAIIICVSGLLLFAVLIGNVQKYLQSSTTRVDEMEE 368

  Fly   824 KLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRV 888
            |....:.:|..|.:|.:|:.::.::.||.|...|.::||..:..||..|:.|....:.|..||:|
plant   369 KKRDTEKWMSYREIPEYLKERIRRFEDYKWRRTKGTEEEALLRSLPKDLRLETKRYLFLKLLKKV 433

  Fly   889 EIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRL-QVVADNGKTVM---ASL 949
            .:.|..:...|..|..||:.|.::...||.|:||..::|..:.||.| ......|:|..   ..|
plant   434 PLLQAMDDQLLDALCARLKTVHYTEKSYIVREGEPVEDMLFIMRGNLISTTTYGGRTGFFNSVDL 498

  Fly   950 KAGSYFGEI---SILNMGTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKR 1011
            .||...|::   ::.::.:.....:.:|:::...:.||:|..|:..|..:|.    ||.|..::.
plant   499 IAGDSCGDLLTWALYSLSSQFPISSRTVQALTEVEGFVISADDLKFVATQYR----RLHSKQLQH 559

  Fly  1012 LEKY 1015
            :.::
plant   560 MFRF 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
CNGC11NP_182167.2 Crp 437..>565 CDD:223736 31/132 (23%)
CAP_ED 437..564 CDD:237999 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.