DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and CNGC3

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001118537.1 Gene:CNGC3 AraportID:AT2G46430 Length:706 Species:Arabidopsis thaliana

Alignment Length:570 Identity:134/571 (23%)
Similarity:233/571 (41%) Gaps:118/571 (21%)


  Fly   550 QKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWS------MVVSMAFLYNFWVIIY----RFAF 604
            ::|....|.:.:.....:|:..|.:|.......|:      .||::||...|:.|.|    ||..
plant    50 KRPLSVHSNKNKENNKKKKILRVMNPNDSYLQSWNKIFLLLSVVALAFDPLFFYIPYVKPERFCL 114

  Fly   605 Q-EINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLED-------GVLQTDALKLRTHYMNSTIF 661
            . :...:|||..|  ....|..|::.:||.|.||::..       |.|......:...|:.| .|
plant   115 NLDKKLQTIACVF--RTFIDAFYVVHMLFQFHTGFITPSSSGFGRGELNEKHKDIALRYLGS-YF 176

  Fly   662 YIDCLCLLPL-DFLYLSIGFNSILRSFR--------LVKIYRFWAFMDRTERHTNYPNLFRSTAL 717
            .||.|.:||: ..:.|:|    :.|..|        |:|...|..::.|..|  .|| ||:....
plant   177 LIDLLSILPIPQVVVLAI----VPRMRRPASLVAKELLKWVIFCQYVPRIAR--IYP-LFKEVTR 234

  Fly   718 IHYLLVIFHWNGC---LYHIIHKNNGFGS-----------RNW---------------------- 746
            ...|:....|.|.   |:..:..::.|||           |.|                      
plant   235 TSGLVTETAWAGAALNLFLYMLASHVFGSFWYLISIERKDRCWREACAKIQNCTHAYLYCSPTGE 299

  Fly   747 ---------------------------VYHDS------ESADVVKQYLQSYYWCTLALTTIG-DL 777
                                       ::.|:      ||.|..|::...::|....|:.:| :|
plant   300 DNRLFLNGSCPLIDPEEITNSTVFNFGIFADALQSGVVESRDFPKKFFYCFWWGLRNLSALGQNL 364

  Fly   778 PKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQ 842
            .....:||.:|.|:..:.||:|||.::|::...:.|.:...:|.:.|....:.:|..|.:|:.|:
plant   365 KTSAFEGEIIFAIVICISGLVLFALLIGNMQKYLQSTTVRVEEMRVKRRDAEQWMSHRMLPDDLR 429

  Fly   843 VKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLR 907
            .::.|:..|.|...|..:||..:|.||..|:.:|..::.|..||:|..||..:...|..|..||:
plant   430 KRIRKYEQYKWQETKGVEEEALLSSLPKDLRKDIKRHLCLKLLKKVPWFQAMDDRLLDALCARLK 494

  Fly   908 PVLFSPGDYICRKGEVGKEMYIVNRGRL-QVVADNGKTVM---ASLKAGSYFGEISILNMGTAGN 968
            .||::...||.|:||..::|..:.||.| ......|:|..   ..|.||.:.|::....:....:
plant   495 TVLYTEKSYIVREGEPVEDMLFIMRGNLISTTTYGGRTGFFNSVDLVAGDFCGDLLTWALDPLSS 559

  Fly   969 RRTASVRSV-GYSDL--FVLSKKDMWDVLKEYPAARVRLESIAVKRLEKY 1015
            :...|.|:| ..:::  |:||..|:..|..:|.    ||.|..::.:.::
plant   560 QFPISSRTVQALTEVEGFLLSADDLKFVATQYR----RLHSKQLRHMFRF 605

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
CNGC3NP_001118537.1 PTEN_C2 <113..181 CDD:287393 18/71 (25%)
Ion_trans 115..406 CDD:278921 63/301 (21%)
Crp 471..>607 CDD:223736 38/140 (27%)
CAP_ED 477..606 CDD:237999 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.