DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and cnga2a

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001038211.1 Gene:cnga2a ZFINID:ZDB-GENE-061005-1 Length:673 Species:Danio rerio

Alignment Length:469 Identity:228/470 (49%)
Similarity:311/470 (66%) Gaps:8/470 (2%)


  Fly   562 AATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLY 626
            |.|..:...|:..||..|.|.|..|::.|.|||:..::.|..|.|:..|...:|..||||||.:|
Zfish   126 AKTKKKSDVFILSPADDLYYRWLFVIASAVLYNWCFVVARACFNELQTRNFILWLFLDYLSDVIY 190

  Fly   627 LIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFN-SILRSFRLV 690
            ::|.....|||:||.|:|..|.:|||..|.::..|.:|.|.::|.|..|:.||.: ..||..||:
Zfish   191 ILDTCVRLRTGFLEQGLLVKDLIKLRESYFHTLQFKLDLLSIIPTDLGYIVIGIHVPELRLNRLM 255

  Fly   691 KIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY---HDSE 752
            :..|.:.|.||||..|:||||||...|:.|:|||.|||.|:|..|.|:.||||..|||   .|.:
Zfish   256 RFSRLFEFFDRTETRTSYPNLFRICNLVLYILVIIHWNACIYFAISKSLGFGSDQWVYPNISDPK 320

  Fly   753 SADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAA 817
            ...:.:.|:...||.||.|||||::|.|....||:||:...|.|:::|||::|:|..::::::|.
Zfish   321 FGTLTRGYVYCLYWSTLTLTTIGEMPAPVQDEEYLFVVFDFLVGVLIFATIVGNVGAMISNMNAT 385

  Fly   818 RKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHL 882
            |.|||.::|.:|.||:.|:|...|:.:|||||||||..:|..||:..:..||:||:|||||||||
Zfish   386 RAEFQGQIDAIKHYMKFRKVSKELEARVIKWFDYLWTNKKTIDEQDVLKNLPNKLRAEIAINVHL 450

  Fly   883 DTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMA 947
            :|||:|.|||:.|||.|.||||:|||.:|||||||||||::||||||:..|.|.||||:|.|..|
Zfish   451 ETLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGCLAVVADDGVTQYA 515

  Fly   948 SLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVK 1010
            .|.|||.||||||||:  ...||||||::||:||||||.|||.|:.:.:.|||.|:..||....:
Zfish   516 HLTAGSCFGEISILNIRGSKMGNRRTANIRSIGYSDLFCLSKGDLMEAVMEYPDAKKVLEEKGRQ 580

  Fly  1011 RLEKYKKAPLEKVK 1024
            .|  .|:..||:|:
Zfish   581 IL--IKEGLLEEVE 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
cnga2aNP_001038211.1 Ion_trans 162..386 CDD:278921 94/224 (42%)
Ion_trans_2 <331..381 CDD:285168 22/50 (44%)
Radical_SAM 407..>472 CDD:302752 40/65 (62%)
Crp 452..>591 CDD:223736 84/141 (60%)
CAP_ED 458..574 CDD:237999 74/116 (64%)
CLZ 574..643 CDD:293134 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.