DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and Hcn4

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_067690.1 Gene:Hcn4 RGDID:71065 Length:1198 Species:Rattus norvegicus

Alignment Length:889 Identity:219/890 (25%)
Similarity:352/890 (40%) Gaps:196/890 (22%)


  Fly   408 NKSRGRLKTAASGDQPLLGTWNRSTGRGSQDN----------TLAGGGATSLAMGGHNQYG---- 458
            ::|||....||..:.|     .||.|:.|.:.          :|...|..|...||.:..|    
  Rat    65 SESRGAALGAADSEGP-----GRSAGKSSTNGDCRRFRGSLASLGSRGGGSGGAGGGSSLGHLHD 124

  Fly   459 -----------GNYCNGTDRYPRSRSQQQGHHNAAQQAHHPYQLQHSASTVSHHPHAHGPPSQGG 512
                       |:...|.||.|...:.:.....||.|                 |.|..||.|  
  Rat   125 SAEERRLIAAEGDASPGEDRTPPGLATEPERPGAAAQ-----------------PAASPPPQQ-- 170

  Fly   513 PGGPGPPHGGHPHHPH-------HGGAGSG-----------GGSG-----------PGSH----- 543
               |..|.......|.       .|||.:.           |.||           ||.:     
  Rat   171 ---PPQPASASCEQPSADTAIKVEGGAAASDQILPEAEVRLGQSGFMQRQFGAMLQPGVNKFSLR 232

  Fly   544 --GGQPHHQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQE 606
              |.    ||......:|:::|.     .::..|.....:||.:.:.:..:.|..:|.....|.:
  Rat   233 MFGS----QKAVEREQERVKSAG-----FWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFK 288

  Fly   607 INRRTIAIWFCLDYLSDFLYLIDILFHFRTG-YLEDGV-LQTDALKLRTHYMNSTIFYIDCLCLL 669
            ....|  .|...:.:||..:|||::.:|||| .:||.. :..|..:::..|:.|. |.:|.:..:
  Rat   289 DENTT--PWIVFNVVSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSW-FVVDFISSI 350

  Fly   670 PLDFLYL------------------SIGFNSILRSFRLVKIYRFWAFMDRTER--HTNY---PNL 711
            |:|:::|                  .:.|..||...||:::.|...::.:.|.  |..|   ..:
  Rat   351 PVDYIFLIVETRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAV 415

  Fly   712 FRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWV-YHDSESADVVKQYLQSYYWCTLALTTIG 775
            .|...||..:|::.||:|||..::.....|....|| .:...:....|||..:.:.....:..||
  Rat   416 VRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSINGMVNNSWGKQYSYALFKAMSHMLCIG 480

  Fly   776 -DLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPN 839
             ....|....:....:|.::.|...:|..:||...::.|:.::|:::|.|...|:.||...::|.
  Rat   481 YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPP 545

  Fly   840 HLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTL-KRVEIFQNTEAGFLCELV 903
            ..:.::..::::.: ..|..|||..:..|.:.|:.|| ||.:...| ..:.:|.|.:..|:..::
  Rat   546 DTRQRIHDYYEHRY-QGKMFDEESILGELSEPLREEI-INFNCRKLVASMPLFANADPNFVTSML 608

  Fly   904 LRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNMGTAGN 968
            .:||..:|.|||||.|:|.:||:||.:..|.:.|:....|.  ..|..|||||||.:|..|    
  Rat   609 TKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKE--TKLADGSYFGEICLLTRG---- 667

  Fly   969 RRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYKKAP---LEKVKY----- 1025
            |||||||:..|..|:.||..:..:||:|||..|...|::|:.||::..|..   |.||::     
  Rat   668 RRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSG 732

  Fly  1026 -FN---------VV----AMGRCQSTPGLVESCGRTSLEEMWLP---------PATAGASSLMHH 1067
             ||         :|    .|..|........|...|....:|.|         .||...:..:.|
  Rat   733 VFNYQENEIIQQIVRHDREMAHCAHRVQAAASATPTPTPVIWTPLIQAPLQAAAATTSVAIALTH 797

  Fly  1068 HQALQQQHQASQQQPHRQESTQTSSQTHGYSPRSYADRLARATDSPRSVSPSAHGSEERPRSRTT 1132
            |..|    .|:..:|  .......:...|.:|| :..||       :|:.|||.||..       
  Rat   798 HPRL----PAAIFRP--PPGPGLGNLGAGQTPR-HPRRL-------QSLIPSALGSAS------- 841

  Fly  1133 SHHSIRPQSQPSHTGHICDSSSQLECYGAGVGGAGGGTTPLLGS 1176
                  |.|.||.......||..::.. ||. .|..|.:|||.|
  Rat   842 ------PASSPSQVDTPSSSSFHIQQL-AGF-SAPPGLSPLLPS 877

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
Hcn4NP_067690.1 Involved in subunit assembly. {ECO:0000250} 209..260 11/60 (18%)
Ion_trans_N 218..260 CDD:285597 8/51 (16%)
Ion_trans 280..525 CDD:278921 57/248 (23%)
Crp 589..>724 CDD:223736 54/141 (38%)
CAP_ED 595..703 CDD:237999 47/114 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 217 1.000 Inparanoid score I3446
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.