DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and cnga3a

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_005166141.1 Gene:cnga3a ZFINID:ZDB-GENE-090611-2 Length:765 Species:Danio rerio

Alignment Length:458 Identity:220/459 (48%)
Similarity:301/459 (66%) Gaps:14/459 (3%)


  Fly   571 FVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFR 635
            ::.|||....|.|..:::....||..:::.|..|.|:......:|..|||.||.:|.:|.....|
Zfish   232 WIMDPASDKYYRWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSR 296

  Fly   636 TGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNS-ILRSFRLVKIYRFWAFM 699
            ||:||.|:|..|:.||..:|.....|..|.:.::|.|...|.:|||: .||..||.|:.|.:.|.
Zfish   297 TGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPELRFNRLFKMARLFEFF 361

  Fly   700 DRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHD---SESADVVKQYL 761
            ||||..|||||:||.:.|:.|:|||.|||.|::..|.|..|||:..|||.:   .|...:.::|:
Zfish   362 DRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYPNISHPEYGRLARKYI 426

  Fly   762 QSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLD 826
            ...||.||.|||||:.|.|....||:||::..|.|:::|||::|:|..::::::|:|.|||||:|
Zfish   427 YCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKID 491

  Fly   827 GVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIF 891
            .:|.||:.|:|...|:.:|||||||||..:|..||:..:..|||||||||||||||||||:|.||
Zfish   492 SIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIF 556

  Fly   892 QNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFG 956
            |:.|||.|.||||:|:|.:||||||||:||::|:||||:..|:|.||||:|.|....|..|:|||
Zfish   557 QDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFG 621

  Fly   957 EISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYKKAP 1019
            |||||.:  ..|||||||::|||||||||.|||.|:.:.|.|||.|:        |.||:..||.
Zfish   622 EISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAK--------KALEEKGKAI 678

  Fly  1020 LEK 1022
            |.|
Zfish   679 LRK 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
cnga3aXP_005166141.1 Ion_trans 272..483 CDD:278921 87/211 (41%)
Crp 549..>671 CDD:223736 76/130 (58%)
CAP_ED 555..671 CDD:237999 72/124 (58%)
CLZ 671..741 CDD:293134 6/12 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.