DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and hcn4l

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_684730.5 Gene:hcn4l ZFINID:ZDB-GENE-110411-3 Length:1188 Species:Danio rerio

Alignment Length:853 Identity:199/854 (23%)
Similarity:338/854 (40%) Gaps:197/854 (23%)


  Fly   502 PHAHGPPSQGGPG-GPGPPHGGHPHHPHHGGAGSGGGSGPGS----------------------H 543
            |...||..|.||| .||.          .||.|.|....|..                      .
Zfish   115 PEDDGPSEQPGPGESPGA----------KGGRGDGAQQAPSEEQSTFVKLEGIDQILPDDERMYQ 169

  Fly   544 GGQPHHQ--------------------KPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVS 588
            .|..|.|                    |......:|:::|.     .::..|.....:||.:::.
Zfish   170 AGFMHRQFGAMLQPGVNKFSLRMFGSEKAVEHEQERVKSAG-----FWIIHPYSDFRFYWDLIML 229

  Fly   589 MAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDG----VLQTDAL 649
            :..:.|..:|.....|.: :..|.| |...:.:||..:|:|::.:||||.:::.    :|....:
Zfish   230 LLMVGNLIIIPVGITFFK-DEHTPA-WIVFNVVSDTFFLVDLVLNFRTGIVKEDSTEIILDPQQI 292

  Fly   650 KLRTHYMNSTIFYIDCLCLLPLDFLYL------------------SIGFNSILRSFRLVKIYRFW 696
            |:|  |:.|. |.:|.|..:|:|:::|                  .:.|..||...||:::.|..
Zfish   293 KVR--YLRSW-FAVDFLSSIPVDYIFLIVETRIDSDFYKTARALRIVRFTKILSLLRLLRLSRLI 354

  Fly   697 AFMDRTER--HTNY---PNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHDSESADV 756
            .::.:.|.  |..|   ..:.|...||..:|::.||:|||..::.....|.|..||..:....|.
Zfish   355 RYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVAKNKMVNDT 419

  Fly   757 -VKQYLQSYYWCTLALTTIG-DLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARK 819
             .:||..:.:.....:..|| .:..|....:....||.::.|...:|..:||...::.|:.::|:
Zfish   420 WGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRR 484

  Fly   820 EFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDT 884
            ::|.|...|:.||...::|..::.::..::::.: ..|..|||..:..|.:.|:.||   :..:.
Zfish   485 QYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRY-QGKMFDEESILGELNEPLREEI---ISFNC 545

  Fly   885 LKRV---EIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVM 946
            .|.|   .:|.|.:..|:..::.:||..:|.|||||.|:|.|||:||.:..|.|.|:....|.  
Zfish   546 RKLVATMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTKGSKE-- 608

  Fly   947 ASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKR 1011
            ..:..|||||||.:|..|    |||||||:..|..|:.||.....:||:|||..|...|::|:.|
Zfish   609 TKISDGSYFGEICLLTRG----RRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFETVALDR 669

  Fly  1012 LEKYKKAPLEKVKYFNVVAMGRCQSTPGLVESCGRTSLEEMWLPPATAGASSLMHHHQALQQQHQ 1076
            |::..|.        |.|...:.|..    .:.|..:.:|                ::.:||..|
Zfish   670 LDRIGKR--------NSVLQHKVQRD----LNSGVLNYQE----------------NEIIQQIVQ 706

  Fly  1077 ASQQQPHRQESTQT-----------SSQTHG-YSPRSYADRLARATDSPRSVSPSAHGSEERPRS 1129
            ..:...|.....||           ||.|.. ::|...|...|.|..:..:::.:.|     |. 
Zfish   707 HDRDMAHCAHLMQTPPPPPHPAPTPSSHTPVIWAPLIQAPLQAAAATTSVAIALTRH-----PH- 765

  Fly  1130 RTTSHHSIRPQSQPSHTGHICDSSSQLECYGAGVGGA---GGGT-----------TPLLGSHEVL 1180
              ..|...||  .....|.:.|.....:.:...:.||   ||.:           ||:|      
Zfish   766 --LPHTLFRP--PVPRLGSLKDQPGYFKRFPTALSGADTFGGSSSTSSQFSSCIETPIL------ 820

  Fly  1181 EDEIKRLRERLHTVESENQALNTKLSQQQWDLENRLAEIEMQICGVSSTSSVDPENETEELERNR 1245
             |.::..|....|....:.:|.:.::...                .::|||:     ||....:.
Zfish   821 -DTLRAERSSTSTPPPSSSSLPSTITTTV----------------TTTTSSI-----TESSVYHH 863

  Fly  1246 ESIIXHGS 1253
            ..||.|||
Zfish   864 RPIISHGS 871

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
hcn4lXP_684730.5 Ion_trans_N 177..219 CDD:285597 4/47 (9%)
Ion_trans 239..484 CDD:278921 60/250 (24%)
Crp 548..>683 CDD:223736 56/149 (38%)
CAP_ED 554..662 CDD:237999 48/114 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 186 1.000 Inparanoid score I3852
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.