DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and Cngb3

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_017449059.1 Gene:Cngb3 RGDID:1565364 Length:694 Species:Rattus norvegicus

Alignment Length:489 Identity:157/490 (32%)
Similarity:264/490 (54%) Gaps:27/490 (6%)


  Fly   538 SGPGSHGGQPHHQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRF 602
            |.|..|    ||:..|....:.:|:....|.:....|   |:...|.::|::|:.:|.|::..|.
  Rat   171 SKPKEH----HHKLQRVPVKEYLRSMRLPRSIDSYTD---RIYLLWLLLVTIAYNWNCWLLPVRL 228

  Fly   603 AF--QEINRRTIAIWFCLDYLSDFLYLIDI-LFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYID 664
            .|  |..:.|.  .|...|.:.|.:||.|| |...|..::..|.:..|:.:|:.||.:||.|.:|
  Rat   229 VFPCQTPDNRN--YWIITDIICDIIYLGDILLIQPRLQFVRGGEIIVDSNELKRHYRSSTKFQMD 291

  Fly   665 CLCLLPLDFLYLSIGFNSILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNG 729
            ...|||.:.||:..|.|.|.|:.|::|...|:.|....|...:...::|......|||.:.|.|.
  Rat   292 VASLLPFEVLYIFFGVNPIFRTNRILKYTSFFEFNHHLESIMDRAYVYRIIRTTGYLLFLLHINA 356

  Fly   730 CLYHIIHKNNGFGSRNWVYHDSESADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLL 794
            |:|:......|.||..|||:...:     :||:.:||....|.|||.||:|::..|.||.:|...
  Rat   357 CVYYWASDYEGIGSTKWVYNGEGN-----KYLRCFYWAVRTLITIGGLPEPQTSFEIVFQLLNFF 416

  Fly   795 FGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCS 859
            .|:.:|::::|.:.:::.:.:|.:..|...:|.:..||....:|...|.:|..|.:|.|.:|:..
  Rat   417 SGVFVFSSLIGQMRDVIGAATANQNNFHVCMDHIIAYMNKYSIPQSTQHRVRTWLEYTWHSQRIL 481

  Fly   860 DEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVG 924
            ||...:..||..::..:||:::.:.:.:||:|:..:...:.:|:|||:..::.|||::|:|||:|
  Rat   482 DESNLLETLPTAMQLSVAIDINFNIIDKVELFKGCDTQMIYDLLLRLKSTIYLPGDFVCKKGEIG 546

  Fly   925 KEMYIVNRGRLQVV-ADNGKTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKK 988
            |||||:..|.:||: ..:|..|:.:||||:.|||||:|..| .||||||.|.:.|:::|..|.||
  Rat   547 KEMYIIKHGEVQVLGGPDGAQVLVTLKAGAVFGEISLLAKG-GGNRRTADVVAHGFANLLTLDKK 610

  Fly   989 DMWDVLKEYPAARVRLESIAVKRLEKYKKAPLEK 1022
            .:.::|..||.::        |.|.|..|..|.:
  Rat   611 TLQEILLHYPTSK--------KLLMKKAKVLLSQ 636



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.