DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and Ih

DIOPT Version :8

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001033948.1 Gene:Ih / 36589 FlyBaseID:FBgn0263397 Length:1327 Species:Drosophila melanogaster

Alignment Length:1271 Identity:285/1272 (22%)
Similarity:451/1272 (35%) Gaps:383/1272 (30%)


  Fly     2 STAKRLVLSLRGRKNSQGNSA-----TSSTRLVSAGTSPGHELDEIAVVSGTGSSS------HHF 55
            |::.||..|...::||..:.:     .||...||.||..         ||.||..|      |.:
  Fly   108 SSSSRLSTSGISKQNSSDSRSGLRILDSSHSPVSCGTQS---------VSSTGGQSALYDACHEY 163

  Fly    56 --SYGGCLATGDAPL--PRYSTAATPSLRRATAIDGDADADADADAGADGNDNENHVDG------ 110
              |.....|.|.|.|  ..||.............|.:.|.|.|.|...|......|:..      
  Fly   164 SRSLSAAAAEGAASLLKSHYSDQQLAQTEPDPEPDPERDRDRDRDRDRDRERERRHLTNLNLNLS 228

  Fly   111 ----YSDDDDD---DERWLRAARAQ-----KVQKAQTQAYAAHNDRPQTKTTVAIRQNNGSNKSN 163
                ||..|..   :|.::....|.     :..|.:.|:....|  ...||..|.::....:|||
  Fly   229 SEYDYSGSDKQQLVNETYIFKCIANSPSFLRTNKIKEQSKKLRN--LSLKTRTAKKKGQIISKSN 291

  Fly   164 SNSNSKCN----------------------SSSSNNNNNYKSATTSQSNINHRLAPRASFPEI-- 204
            :.|::..:                      |:||:.|..:..|:::.::.:.........|.:  
  Fly   292 AVSDNSLHPGDKYLNLYLVEKKHSLQPQVASTSSSINTTHPQASSAPASSSSTCTKAPQLPALSA 356

  Fly   205 ---MQPRLSLNGLL-----------NPSLMPSPRPLYRDH----SSRSINPLTAYEQQMAELDGS 251
               .|.:|.|||.|           :...:|..|...|..    ||.:| |.|.....:..    
  Fly   357 VAARQQQLLLNGSLKGKGQSQSQGQSRQTLPGHRASVRSESGSGSSHTI-PATGKSPPVPH---- 416

  Fly   252 FYASNAGYLGAGMGGSAGDGTTCTNLTVGGGSTGG-GAMASGGGGTSAQVGGGGGGSGGGGAAIH 315
                   .|.|.:..||.....|..|:....|... .|.|.|.|      .|.|.|||.|.    
  Fly   417 -------SLAAKISSSASGSKNCNLLSASSNSCHKLNAHAQGSG------AGSGSGSGSGS---- 464

  Fly   316 TTELSITPTMAGDEQFIDLGSLRRFSIDRQSFLDLGPKFGMTQPKFGQSVSQQGFFTSHDSLATP 380
                                               ||.        |.         ||.:.|:|
  Fly   465 -----------------------------------GPP--------GH---------SHYAAASP 477

  Fly   381 CASRASNSHMATVSTASEMDLLHNKQRNKSRGRLKTAASGDQPLLGTWNRSTGRGSQDNTLAGGG 445
            .:|.:||.|:       ....|.:..|.|:....:.:|..|..     :.|:..|||..      
  Fly   478 KSSVSSNGHL-------NKYCLTDLTRRKAEFNRQLSAPTDYT-----HHSSSNGSQQE------ 524

  Fly   446 ATSLAMGGHNQYGGNYCNGTDR-----YPRSRSQQQGHHNAAQQAHHPYQLQHSA---STVSHHP 502
            .:|.|..||...|.:.......     :|.|......||  |..|..|..|:.|.   |..||||
  Fly   525 GSSEANEGHEPVGESTITVASAGVSYPHPYSYPYHYAHH--ASSATAPANLKASLQLHSFGSHHP 587

  Fly   503 HAHGPPSQGGPGGPGPPHGGHPHH--PHHGGAGSGGGSGPGSHG--------------------- 544
                .|....|......:..:..|  .|.|..|....||.....                     
  Fly   588 ----CPYPARPTSTSCTNSFNRRHIRRHKGKLGDRLLSGDSEESVRCSYCSVLNVNDNDLRISFE 648

  Fly   545 ----------------------------------GQPHHQ------------------------- 550
                                              |.|..:                         
  Fly   649 NTCTDSLVTAFDDEALLICDQGTEMVHFDDVSLYGTPKEEPMPNIPIVSEKVSANFLKSQLQSWF 713

  Fly   551 KP-------------RRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRF 602
            :|             :....:|||..|:.   |:|..|.....:||.:.:.:..:.|  :||...
  Fly   714 QPTDNRLAMKLFGSRKALVKERIRQKTSG---HWVIHPCSSFRFYWDLCMLLLLVAN--LIILPV 773

  Fly   603 AFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYL-EDGVLQT--DALKLRTHYMNSTIFYID 664
            |....|......|...:.|||.::||||:.:||||.: :|...|.  |...:..||:. |.|::|
  Fly   774 AISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLR-TWFFLD 837

  Fly   665 CLCLLPLDFLYLSIGFNSILR------SF---------------------RLVKIYRFWAFMDRT 702
            .:..:|||:::|.  ||.|::      ||                     ||:::.|...::.:.
  Fly   838 LISSIPLDYIFLI--FNQIMKLQDFSDSFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQW 900

  Fly   703 ERHTNYPNLFRSTA-----------------------------------LIHYLLVIFHWNGCLY 732
            |......||.:.:|                                   ||..:|:|.||:|||.
  Fly   901 EEVYILQNLQKKSADRRGRMNRKDKDGLTKSNLILKFLNMASVFMRIFNLICMMLLIGHWSGCLQ 965

  Fly   733 HIIHKNNGFGSRNWVYHDSESADVVKQ--YLQSYYWCTLALTT------IGDLPKPRSKGEYVFV 789
            .::....||.|.:||     |.:.:::  :|:.|.|......:      .|..| |:|..:....
  Fly   966 FLVPMLQGFPSNSWV-----SINELQESYWLEQYSWALFKAMSHMLCIGYGRFP-PQSLTDMWLT 1024

  Fly   790 ILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWL 854
            :|.::.|...:|..|||..|::.|:.::|::::.|:..|:.||..|::|..::.::.::|::.: 
  Fly  1025 MLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRY- 1088

  Fly   855 TQKCSDEERAVSCLPDKLKAEIAINVHLDTL-KRVEIFQNTEAGFLCELVLRLRPVLFSPGDYIC 918
            ..|..|||..:..|.:||:.:: ||.:..:| ..|..|.|.::.|:.::|.:|:..:|.|||.|.
  Fly  1089 QGKFFDEELILGELSEKLREDV-INYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIII 1152

  Fly   919 RKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLF 983
            ::|.:|.:||.:..|.:.:|..||: |..||..|||||||.:|    ...||.||||:..|.:||
  Fly  1153 KEGTIGTKMYFIQEGVVDIVMANGE-VATSLSDGSYFGEICLL----TNARRVASVRAETYCNLF 1212

  Fly   984 VLSKKDMWDVLKEYPAARVRLESIAVKRLEKYKKAP 1019
            .||......||.:||..|..:|::|.:||.|..|.|
  Fly  1213 SLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNP 1248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
IhNP_001033948.1 Ion_trans_N 709..751 CDD:285597 8/45 (18%)
Ion_trans 771..1054 CDD:278921 69/292 (24%)
Crp 1118..>1241 CDD:223736 50/128 (39%)
CAP_ED 1124..1233 CDD:237999 45/114 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.