DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and Cnga4

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001028489.1 Gene:Cnga4 MGIID:2664099 Length:575 Species:Mus musculus

Alignment Length:470 Identity:197/471 (42%)
Similarity:292/471 (62%) Gaps:6/471 (1%)


  Fly   554 RTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCL 618
            :|......|.|.|||...|.||:|...|:|...:....:||..:::.|..|.::....:..||.|
Mouse     8 KTTESTPPAPTKARKWLPVLDPSGDYYYWWLNTMVFPIMYNLIIVVCRACFPDLQHSYLVAWFVL 72

  Fly   619 DYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFN-S 682
            ||.||.|||:||...|.||:||.|:|..|...:.:.|:.:..|.:|...|:|.|..|:.:|.: .
Mouse    73 DYTSDLLYLLDIGVRFHTGFLEQGILVVDKSMIASRYVRTWSFLLDLASLVPTDAAYVQLGPHIP 137

  Fly   683 ILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWV 747
            .||..|.:::.|.:...||||..|.|||.||...|:.|:.|:.|||.|||..:.:..|||...||
Mouse   138 TLRLNRFLRVPRLFEAFDRTETRTAYPNAFRIAKLMIYIFVVIHWNSCLYFALSRYLGFGRDAWV 202

  Fly   748 YHDSESAD---VVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVAN 809
            |.|.....   :.:|||.|:|:.||.|||:||.|.|..:.||:|::...|..:|.|||::|.:::
Mouse   203 YPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPLPAREEEYLFMVGDFLLAVMGFATIMGSMSS 267

  Fly   810 IVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKA 874
            ::.:::.|...|......||.||:::.|...|:.:||.|:.:|.:.:|.::|...:..||::|:|
Mouse   268 VIYNMNTADAAFYPDHALVKKYMKLQHVNRRLERRVIDWYQHLQINKKMTNEVAILQHLPERLRA 332

  Fly   875 EIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVA 939
            |:|::|||.||.||:||||.||..|.||||:|:|..:|||:|:||||::|:||||:..|:|.|||
Mouse   333 EVAVSVHLSTLSRVQIFQNCEASLLEELVLKLQPQTYSPGEYVCRKGDIGREMYIIREGQLAVVA 397

  Fly   940 DNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARV 1002
            |:|.|..|.|.||.|||||||:|:  ..:||||||:::|:||||||.|||:|:.:||.|||.|:.
Mouse   398 DDGVTQYAVLGAGLYFGEISIINIKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQA 462

  Fly  1003 RLESIAVKRLEKYKK 1017
            .:|....:.|.|..|
Mouse   463 VMEEKGREILLKMNK 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
Cnga4NP_001028489.1 Ion_trans 58..273 CDD:278921 82/215 (38%)
P-loop_NTPase 116..>174 CDD:304359 21/58 (36%)
IQ-type. {ECO:0000250} 292..302 2/10 (20%)
Crp 342..>519 CDD:223736 77/137 (56%)
CAP_ED 348..464 CDD:237999 69/116 (59%)
CLZ 464..535 CDD:293134 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.