DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and cng-2

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001343690.1 Gene:cng-2 WormBaseID:WBGene00022295 Length:819 Species:Caenorhabditis elegans

Alignment Length:725 Identity:199/726 (27%)
Similarity:313/726 (43%) Gaps:163/726 (22%)


  Fly   467 RYPRSRSQQQGHHNAAQQAHHPYQLQHSASTVSHHPHAHGPPSQGGPGGPGPPHGGHPHHP---- 527
            ||.|:.|.:.....|.:.:.....:..::.:|........|.|..|...|.|.....||.|    
 Worm    27 RYLRALSAKNQERTANEHSSVDVAVTQASLSVPRPGILRLPSSDPGEEDPQPSTSSIPHRPSKWA 91

  Fly   528 ----------------------HH---------------GGAGSGGGSGPGSH------------ 543
                                  ||               ..|.:||...||..            
 Worm    92 TVREKSPQIIGGHAKEVTFQERHHKLDLNKSRSTSKNRRKSAQNGGAEDPGQKSFSDVVKTAMML 156

  Fly   544 ----GGQPHHQK---PRRTASQRIRAATAA------------------------------RKLHF 571
                ....|.::   |.|.|:......|||                              |||::
 Worm   157 RTWISAMEHDERESEPDRDATTTNAEITAADDRSILPSPPIFQQRQTGFTQIKDILTDKCRKLYY 221

  Fly   572 VF-DPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFR 635
            .: .......|||:.::|:..|||.:.::. |.|.:::......|..::...||.:|:|.|...|
 Worm   222 FYVTENSTFFYYWTAIISIGILYNMFAMVI-FIFDDVHFGYFNQWLYVNLFFDFCFLLDCLVGSR 285

  Fly   636 TGYLEDG--VLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFN-SILRSFRLVKIYRFWA 697
            ..::.:|  |.|||  |:..:|..|....:|.|||.|.|| ||.|... |::|:.||||.||.:.
 Worm   286 MTFVSEGNEVSQTD--KMFKNYRQSRRCKLDLLCLAPADF-YLFIDTKASLVRAIRLVKAYRLYE 347

  Fly   698 FMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHII--------HKNNGFG------------ 742
            |:..|:|.|::|:..:...|.....::||||.|:|.:.        ...|.||            
 Worm   348 FIMLTQRRTDFPHFMKILFLTSSCAILFHWNACVYFLFSLYQGLTEDDPNAFGFSYYKVFDPRFS 412

  Fly   743 ------SRNWVY-HDSESADV---------------------------VKQYLQSYYWCTLALTT 773
                  .::..| .|:|..|:                           .::|..:.||.:|.:|.
 Worm   413 ICDALYDQDCYYPEDTEVLDIRDERPHYMEDMYKFWDKKFNILQIGNFSREYSMTIYWSSLTITK 477

  Fly   774 IGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVP 838
            .|..|.|....:....|...|.|:::|||::|.|.::||.:|....:|:..:||:|.||:.|.|.
 Worm   478 CGQQPWPSKSSQNSLEIFDTLIGVLVFATIIGGVGSVVTQMSQNVNDFREMMDGIKFYMKYRGVQ 542

  Fly   839 NHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELV 903
            :.:|.:|:..|.||....:..|||..:|.||...:|.||.|:|.|||.:|.:|...:...|.|:|
 Worm   543 SAIQDRVLNCFLYLNSHNQLYDEEEILSLLPPFFQARIAANLHQDTLSKVSLFYKCDQRLLQEVV 607

  Fly   904 LRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTA 966
            :.::..::||.||:|||.|..|||:||.:|.|.|:.|:....:.|||.|..|||:||:.:  ...
 Worm   608 MLVKQQVYSPNDYLCRKNEKAKEMFIVKKGLLAVIDDDTGVELDSLKEGHTFGELSIVQVKGNIL 672

  Fly   967 GNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYKKAPLEKVKYFNVVAM 1031
            |:||:.|:|||||||::||.:.|:..:|:|||..||||...|.:.|  :.:..||..:      :
 Worm   673 GDRRSVSLRSVGYSDVYVLHQDDVTRLLQEYPEERVRLMENARRML--HSRGLLETNE------L 729

  Fly  1032 GR-CQSTPGL 1040
            |. |::..||
 Worm   730 GEMCETDDGL 739

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
cng-2NP_001343690.1 Ion_trans 232..>407 CDD:306908 57/179 (32%)
Ank_2 <457..>713 CDD:330894 99/256 (39%)
CAP_ED 594..711 CDD:237999 52/117 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.