DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and cng-1

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001122918.1 Gene:cng-1 WormBaseID:WBGene00000562 Length:661 Species:Caenorhabditis elegans

Alignment Length:516 Identity:179/517 (35%)
Similarity:274/517 (53%) Gaps:78/517 (15%)


  Fly   569 LHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEIN---RRTIAIWFCLDYLSDFLYLIDI 630
            :.|..|......|.|:.:||:..|:.. |......||:::   |.|..    |:.|.|.:.::|:
 Worm    69 MSFTVDEHSNTFYLWTGLVSLVALHPL-VFTALSVFQDVHPFLRNTGP----LNLLLDLVNILDL 128

  Fly   631 LFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNSIL---RSFRLVKI 692
            :.|.|..|:|:||...:..||..|.:.||.|.:|.:.::|.:.|::   |....   |..||.|.
 Worm   129 IAHTRIEYVENGVAVKNLSKLMHHRLKSTFFILDVIAVVPAESLHI---FGDSFFWSRINRLTKC 190

  Fly   693 YRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGS---RNWVY------ 748
            ||.:.|..:|:..|..|:.|....||...:||||||||||..|.|...:.:   .:|::      
 Worm   191 YRLFDFSTQTDTRTTSPHAFGLFKLIFICVVIFHWNGCLYFYISKVYNYTTARLEHWIFSYDKII 255

  Fly   749 --------------------------HDSES----------------------ADVVKQYLQSYY 765
                                      |..|:                      |:..:||..|:|
 Worm   256 NPILATCVTDIPNHRDFCDTDDLLITHLPENEVQFTVTDYMTTWENKTTTIKFANFFRQYALSFY 320

  Fly   766 WCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKT 830
            |..|.|.|:|:.|.|.:..:..|.|...|.||::||.::|.|.|:|.:::..:.||:..|||.|.
 Worm   321 WSALTLVTLGEQPSPCTTFQNAFEIGDTLLGLVIFAVIVGDVGNMVVAINLRKSEFENVLDGCKR 385

  Fly   831 YMRMRRVPNHLQVKVIKWFDYLWLTQKCS-DEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNT 894
            :|..|:|||.|:.|.:::|.|:|...... |||.....||.:|..|||:.:|:||||:|::|::.
 Worm   386 FMVYRKVPNLLRKKAVEYFAYVWAHGGAQVDEEEIAEFLPPRLFGEIAVEIHMDTLKKVKLFESC 450

  Fly   895 EAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEIS 959
            :...|.||:|:|:..::||.||||:||:||.|||||..|.::||:::|:|:..:|.||..|||:|
 Worm   451 DPRLLYELILKLQLRVYSPMDYICKKGDVGTEMYIVKEGFVEVVSEDGQTIFVTLPAGFVFGELS 515

  Fly   960 ILNMGTAGNR----RTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYK 1016
            |||:  .||:    |||||||.|||||:||.|:|:|:.|.|||.|:..|....::.|||.|
 Worm   516 ILNI--PGNKNKNLRTASVRSKGYSDLYVLDKEDLWEALHEYPQAKDSLIQKGIQILEKDK 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
cng-1NP_001122918.1 CAP_ED 446..563 CDD:237999 61/119 (51%)
CLZ 562..633 CDD:293134 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.