DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and Cnga3

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_001268939.1 Gene:Cnga3 MGIID:1341818 Length:669 Species:Mus musculus

Alignment Length:628 Identity:250/629 (40%)
Similarity:351/629 (56%) Gaps:100/629 (16%)


  Fly   509 SQGGPGGPGPPHGGHPHHPHHGGAGSGGGSGPGSHGGQPHHQKPRRTASQRIRAATAARKLHFVF 573
            :|..||...||                       .||:...::|                  .|.
Mouse   117 AQPNPGEQKPP-----------------------DGGEGRKEEP------------------IVV 140

  Fly   574 DPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGY 638
            ||:..:.|.|...:::...||:.:::.|..|.|:....:.:|..|||.:|.||::|:|...|||:
Mouse   141 DPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGF 205

  Fly   639 LEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFN-SILRSFRLVKIYRFWAFMDRT 702
            ||.|::..|..:|..||..:..|.:|.|.|:|.|..||.:|.| ..||..||:|..|.:.|.|||
Mouse   206 LEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYLKLGVNYPELRFNRLLKFSRLFEFFDRT 270

  Fly   703 ERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHDS---ESADVVKQYLQSY 764
            |..|||||:||...|:.|.|:|.|||.|:|..|.|..|||:.:|||.::   |.|.:.::|:.|.
Mouse   271 ETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPEYARLSRKYIYSL 335

  Fly   765 YWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVK 829
            ||.||.|||||:.|.|....||:||::..|.|:::|||::|:|.:::::::|.|.|||||:|.||
Mouse   336 YWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVK 400

  Fly   830 TYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNT 894
            .||:.|:|...|:.:||:||||||..:|..||:..:..|||||||||||||||||||:|.|||:.
Mouse   401 QYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDC 465

  Fly   895 EAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEIS 959
            |||.|.||||:|||.:||||||||:||::|:||||:..|:|.||||:|.|....|..||||||||
Mouse   466 EAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEIS 530

  Fly   960 ILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL---------------ESI 1007
            |||:  ..:||||||::||:||||||.|||.|:.:.|.|||.|:..|               |.:
Mouse   531 ILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLIDEDL 595

  Fly  1008 AVKRLEKYKKAPLEKVKYFNVVAMGRCQSTPGLVESCGRTSLEEMWLPPATAGASSLMHHHQALQ 1072
            ...|::  .:...|||:|.                   .:||:            .|......|.
Mouse   596 VAARVD--TRDVEEKVEYL-------------------ESSLD------------ILQTRFARLL 627

  Fly  1073 QQHQASQQQPHRQESTQTSSQTH----GYSPRSYADRLARATD 1111
            .::.|||.: .:|..|:..||.:    |:||.......|..||
Mouse   628 AEYSASQMK-LKQRLTRLESQMNRRCCGFSPDRENSEDASKTD 669

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
Cnga3NP_001268939.1 Ion_trans 165..387 CDD:278921 93/222 (42%)
Radical_SAM 422..>475 CDD:302752 36/53 (68%)
Crp 455..>577 CDD:223736 76/122 (62%)
CAP_ED 461..577 CDD:237999 72/116 (62%)
CLZ 577..647 CDD:293134 17/104 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.