DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and Cnga2

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_031750.2 Gene:Cnga2 MGIID:108040 Length:664 Species:Mus musculus

Alignment Length:483 Identity:229/484 (47%)
Similarity:311/484 (64%) Gaps:26/484 (5%)


  Fly   529 HGGAGSGGGSGPGSHGGQPHHQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLY 593
            |.|.|.|...|.|.                    .|..:...||.||||...|.|..|::|..||
Mouse   111 HQGDGKGDKDGEGK--------------------GTKKKFELFVLDPAGDWYYRWLFVIAMPVLY 155

  Fly   594 NFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNS 658
            |:.:::.|..|.::.|....:|..|||.||.:|:.|::...|||:||.|:|..|..|||.:|:::
Mouse   156 NWCLLVARACFSDLQRNYFVVWLVLDYFSDTVYIADLIIRLRTGFLEQGLLVKDPKKLRDNYIHT 220

  Fly   659 TIFYIDCLCLLPLDFLYLSIGFNS-ILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLL 722
            ..|.:|...::|.|.:|.::|.:| .:|..||:...|.:.|.||||..|:|||:||.:.|:.|:|
Mouse   221 LQFKLDVASIIPTDLIYFAVGIHSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYIL 285

  Fly   723 VIFHWNGCLYHIIHKNNGFGSRNWVY---HDSESADVVKQYLQSYYWCTLALTTIGDLPKPRSKG 784
            ||.|||.|:|:.|.|:.|||...|||   .|.|...:.::|:...||.||.|||||:.|.|....
Mouse   286 VIIHWNACIYYAISKSIGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDE 350

  Fly   785 EYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWF 849
            ||:|||...|.|:::|||::|:|.:::::::|.|.|||||:|.||.||:.|:|...::.||||||
Mouse   351 EYLFVIFDFLIGVLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEAKVIKWF 415

  Fly   850 DYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPG 914
            ||||..:|..||...:..||.||:|||||||||.|||:|.|||:.|||.|.||||:|||.:||||
Mouse   416 DYLWTNKKTVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPG 480

  Fly   915 DYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSV 977
            |||||||::||||||:..|:|.||||:|.|..|.|.|||.||||||||:  ...||||||::||:
Mouse   481 DYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSL 545

  Fly   978 GYSDLFVLSKKDMWDVLKEYPAARVRLE 1005
            ||||||.|||.|:.:.:.|||.|:..||
Mouse   546 GYSDLFCLSKDDLMEAVTEYPDAKKVLE 573

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
Cnga2NP_031750.2 Ion_trans 176..384 CDD:278921 87/208 (42%)
Radical_SAM 417..>470 CDD:302752 33/53 (62%)
Crp 450..626 CDD:223736 80/125 (64%)
CAP_ED 456..572 CDD:237999 74/116 (64%)
CLZ 572..641 CDD:293134 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3407
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.