DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and CNGA3

DIOPT Version :8

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_011508856.1 Gene:CNGA3 / 1261 HGNCID:2150 Length:749 Species:Homo sapiens

Alignment Length:731 Identity:275/732 (38%)
Similarity:401/732 (55%) Gaps:105/732 (14%)


  Fly   406 QRNKSRGRLKTAASGDQPLLGTWNRSTGRGSQDNTLAGGGATSLAMGGHNQYGGNYCNGTDRYPR 470
            |:.....::..|||..:||:| |   |...::|    ||..:.:|:.|.              |.
Human    77 QKKSQPEKVVRAASRGRPLIG-W---TQWCAED----GGDESEMALAGS--------------PG 119

  Fly   471 SRSQQQGHHN---------AAQQAHHPYQ-------------LQHSASTVSHHPHAHGPPSQGGP 513
            ..|..||..:         ||:..||..|             |:..:|..|:        :|...
Human   120 CSSGPQGRLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESN--------AQANV 176

  Fly   514 GGPGPPHGGHPHHPHHGGAGSGGGSGPGSHGGQPHHQKPRRTASQRIRAATAARKLHFVFDPAGR 578
            |...|...|                    ....|..:....|::.........:|...|.||:..
Human   177 GSQEPADRG--------------------RSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSSN 221

  Fly   579 LCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGV 643
            |.|.|...:::...||::::|.|..|.|:....:.:|..|||.:|.||::|:|...|||:||.|:
Human   222 LYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGL 286

  Fly   644 LQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFN-SILRSFRLVKIYRFWAFMDRTERHTN 707
            :.:|..:|..||..:|.|.:|.|.|:|.|..||.:|.| ..:|..||:|..|.:.|.||||..||
Human   287 MVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYLKVGTNYPEVRFNRLLKFSRLFEFFDRTETRTN 351

  Fly   708 YPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHD---SESADVVKQYLQSYYWCTL 769
            |||:||...|:.|:|:|.|||.|:|..|.|..|||:.:|||.:   .|...:.::|:.|.||.||
Human   352 YPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLYWSTL 416

  Fly   770 ALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRM 834
            .|||||:.|.|....||:||::..|.|:::|||::|:|.:::::::|:|.|||||:|.:|.||:.
Human   417 TLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQF 481

  Fly   835 RRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFL 899
            |:|...|:.:||:||||||..:|..||:..:..|||||||||||||||||||:|.|||:.|||.|
Human   482 RKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLL 546

  Fly   900 CELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM- 963
            .||||:|||.:||||||||:||::||||||:|.|:|.||||:|.|....|..|||||||||||: 
Human   547 VELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIK 611

  Fly   964 -GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYKKAPLEKVKYFN 1027
             ..:||||||::||:||||||.|||.|:.:.|.|||.|:..||       ||.::..::.    |
Human   612 GSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALE-------EKGRQILMKD----N 665

  Fly  1028 VV--AMGRCQSTPGLVESCGRTSLEEMWLPPATAGAS--SLMHHHQALQQQHQASQQQPHRQEST 1088
            ::  .:.|..:.|..:|.    .:|::       |:|  :|......|..::.|:|.: .:|..:
Human   666 LIDEELARAGADPKDLEE----KVEQL-------GSSLDTLQTRFARLLAEYNATQMK-MKQRLS 718

  Fly  1089 QTSSQTHGYSPRSYAD 1104
            |..||..|...:..||
Human   719 QLESQVKGGGDKPLAD 734

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
CNGA3XP_011508856.1 Ion_trans 241..465 CDD:278921 94/224 (42%)
Crp 531..>701 CDD:223736 90/192 (47%)
CAP_ED 537..653 CDD:237999 74/116 (64%)
CLZ 653..723 CDD:293134 18/93 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.