DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and CNGA2

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_005131.1 Gene:CNGA2 HGNCID:2149 Length:664 Species:Homo sapiens

Alignment Length:578 Identity:237/579 (41%)
Similarity:327/579 (56%) Gaps:83/579 (14%)


  Fly   495 ASTVSHHPHAHGPPSQGGPGGPGPPHGGHPHH------------------PHHGGAG-------- 533
            :|..::|.| |.||:....|.........||.                  |..|.:|        
Human    10 SSPANNHNH-HAPPAIKANGKDDHRTSSRPHSAADDDTSSELQRLADVDAPQQGRSGFRRIVRLV 73

  Fly   534 ----------------------------------SGGGSGPGSHGGQPHHQKPRRTASQRIRAAT 564
                                              :..|.|.|...|:....|             
Human    74 GIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQEGDGKGDKDGEDKGTK------------- 125

  Fly   565 AARKLH-FVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLI 628
              :|.. ||.||||...|.|..|::|..|||:.:::.|..|.::.:....:|..|||:||.:|:.
Human   126 --KKFELFVLDPAGDWYYCWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDYVSDVVYIA 188

  Fly   629 DILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNS-ILRSFRLVKI 692
            |:....|||:||.|:|..|..|||.:|:::..|.:|...::|.|.:|.::..:| .:|..||:..
Human   189 DLFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDVASIIPTDLIYFAVDIHSPEVRFNRLLHF 253

  Fly   693 YRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY---HDSESA 754
            .|.:.|.||||..|||||:||.:.|:.|:|||.|||.|:|:.|.|:.|||...|||   .|.|..
Human   254 ARMFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIYYAISKSIGFGVDTWVYPNITDPEYG 318

  Fly   755 DVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARK 819
            .:.::|:...||.||.|||||:.|.|....||:|||...|.|:::|||::|:|.:::::::|.|.
Human   319 YLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIGVLIFATIVGNVGSMISNMNATRA 383

  Fly   820 EFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDT 884
            |||||:|.||.||:.|:|...::.|||:||||||..:|..||...:..||.||:|||||||||.|
Human   384 EFQAKIDAVKHYMQFRKVSKGMEAKVIRWFDYLWTNKKTVDEREILKNLPAKLRAEIAINVHLST 448

  Fly   885 LKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASL 949
            ||:|.||.:.|||.|.||||:|||.:|||||||||||::||||||:..|:|.||||:|.|..|.|
Human   449 LKKVRIFHDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALL 513

  Fly   950 KAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLE 1005
            .|||.||||||||:  ...||||||::||:||||||.|||.|:.:.:.|||.|:..||
Human   514 SAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVTEYPDAKKVLE 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
CNGA2NP_005131.1 Ion_trans 174..382 CDD:278921 87/208 (42%)
Radical_SAM 415..>468 CDD:302752 32/53 (60%)
Crp 448..632 CDD:223736 79/125 (63%)
CAP_ED 454..570 CDD:237999 73/116 (63%)
CLZ 570..639 CDD:293134 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3407
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.