DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and cnga2b

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_009299687.1 Gene:cnga2b ZFINID:ZDB-GENE-050307-2 Length:682 Species:Danio rerio

Alignment Length:667 Identity:251/668 (38%)
Similarity:355/668 (53%) Gaps:99/668 (15%)


  Fly   362 GQSVSQQGFFTSHDSLATPCASRASNSHMATVSTASEMDLLHNKQRNKSRGRLKTAASGDQPLLG 426
            |||..:          .:||      ||..:|.|..:       :::::...|..:.|.......
Zfish    12 GQSAPE----------GSPC------SHRLSVQTQED-------EQDRAESVLSRSQSACDDTSS 53

  Fly   427 TWNRSTGRGSQD----NTLAGGGATS----LAMGGHNQYGGNYCNGTDRYPRSRSQQQGHHNAAQ 483
            ...|......||    |:..|.||.|    |.:                    ..::..|.:..:
Zfish    54 ELQRVAALEPQDAPSRNSFRGRGALSRLVTLVV--------------------TLREWAHRSLVE 98

  Fly   484 QAHHPYQLQHSASTVSHHPHAHGPPSQGGPGGPGPPHGGHPHHPHHGGAGSGGGSGPGSHGGQPH 548
            :...|    .|.......|....|||:.....|                                
Zfish    99 EEERP----DSFLERFRGPEVRAPPSRRSNNQP-------------------------------- 127

  Fly   549 HQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIA 613
                  .|:...:..|..:...|:...:....|||...::.|.|||:.:::.|..|.::...|..
Zfish   128 ------DANGNTKGITKKQWETFIVASSDDTYYYWLFFIAAAVLYNWVLLVARACFDQLQSETPI 186

  Fly   614 IWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSI 678
            :|..|||:.||:|::|.....||||||.|:|..|..|||..|:::..|.:|.|.:||.|..|:..
Zfish   187 VWLVLDYICDFVYILDSCIRLRTGYLEQGLLVKDLAKLRDSYIHTFQFKLDVLSILPTDLAYIIT 251

  Fly   679 GFNS-ILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFG 742
            |.|: .||..||::..|.:.|.:|||..|||||:||...|:.|:|||.|||.|:::.|.|:.|||
Zfish   252 GINTPQLRFNRLLRFSRMFEFFNRTETRTNYPNIFRIWNLVLYILVIIHWNACIFYAISKSLGFG 316

  Fly   743 SRNWVY---HDSESADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVL 804
            |..|||   ..:|...:.:.|:..:||.||.|||||::|.|....|||||:...|.|:::|||::
Zfish   317 SDEWVYPNISSTEEGALRRSYIYCFYWSTLTLTTIGEMPPPVRDEEYVFVVFDFLVGVLIFATIV 381

  Fly   805 GHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLP 869
            |:|.:::::::|.|.||||::|.:|.||..|:|..||:.:|||||||||..||..||:..:..||
Zfish   382 GNVGSMISNMNATRAEFQARIDAIKHYMHFRKVSRHLETRVIKWFDYLWTNQKAVDEQEVLKNLP 446

  Fly   870 DKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGR 934
            |||:|||||||||.|||:|.|||:.|||.|.||||:|||.::||||||||||::||||||:..|:
Zfish   447 DKLRAEIAINVHLTTLKKVRIFQDCEAGLLVELVLKLRPQVYSPGDYICRKGDIGKEMYIIKEGK 511

  Fly   935 LQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEY 997
            |.||||:|.|..|.|.||..||||||||:  ...||||||::||:||||||.|||.|:.:.:.||
Zfish   512 LAVVADDGVTQFALLTAGGCFGEISILNIQGSKMGNRRTANIRSIGYSDLFCLSKDDLMEAVIEY 576

  Fly   998 PAARVRLESIAVKRLEK 1014
            |.|:..||....:.|.|
Zfish   577 PDAQRVLEERGREILRK 593

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
cnga2bXP_009299687.1 Ion_trans 153..395 CDD:306908 100/242 (41%)
CAP_ED 467..583 CDD:237999 72/116 (62%)
CLZ 583..653 CDD:318679 4/12 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45638
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.