DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and LOC103690077

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_008757303.1 Gene:LOC103690077 RGDID:9430164 Length:561 Species:Rattus norvegicus

Alignment Length:467 Identity:226/468 (48%)
Similarity:313/468 (67%) Gaps:14/468 (3%)


  Fly   553 RRTASQRIRAATAARKL--------HFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINR 609
            |..||:.:.::|....:        .||.||||...|.|..|::|..|||:.:::.|..|.::.|
  Rat     4 RILASETLSSSTLVTSICLFRKKFELFVLDPAGDWYYRWLFVIAMPVLYNWCLLVARACFSDLQR 68

  Fly   610 RTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFL 674
            ....:|..|||.||.:|:.|::...|||:||.|:|..|..|||.:|:::..|.:|...::|.|.:
  Rat    69 NYFVVWLVLDYFSDTVYIADLIIRLRTGFLEQGLLVKDPKKLRDNYIHTLQFKLDVASIIPTDLI 133

  Fly   675 YLSIGFNS-ILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKN 738
            |.::|.:| .:|..||:...|.:.|.||||..|:|||:||.:.|:.|:|||.|||.|:|::|.|:
  Rat   134 YFAVGIHSPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLVLYILVIIHWNACIYYVISKS 198

  Fly   739 NGFGSRNWVY---HDSESADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLF 800
            .|||...|||   .|.|...:.::|:...||.||.|||||:.|.|....||:|||...|.|:::|
  Rat   199 IGFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIGVLIF 263

  Fly   801 ATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAV 865
            ||::|:|.:::::::|.|.|||||:|.||.||:.|:|...::.||||||||||..:|..||...:
  Rat   264 ATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKDMEAKVIKWFDYLWTNKKTVDEREVL 328

  Fly   866 SCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIV 930
            ..||.||:|||||||||.|||:|.|||:.|||.|.||||:|||.:|||||||||||::||||||:
  Rat   329 KNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGKEMYII 393

  Fly   931 NRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDV 993
            ..|:|.||||:|.|..|.|.|||.||||||||:  ...||||||::||:||||||.|||.|:.:.
  Rat   394 KEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEA 458

  Fly   994 LKEYPAARVRLE 1005
            :.|||.|:..||
  Rat   459 VTEYPDAKKVLE 470

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
LOC103690077XP_008757303.1 Ion_trans 73..281 CDD:278921 87/208 (42%)
Radical_SAM 314..>367 CDD:302752 33/53 (62%)
Crp 347..523 CDD:223736 80/125 (64%)
CAP_ED 353..469 CDD:237999 74/116 (64%)
CLZ 469..538 CDD:293134 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.