DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42260 and cngb3

DIOPT Version :8

Sequence 1:NP_001356969.1 Gene:CG42260 / 37614 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_017950391.1 Gene:cngb3 / 100497119 XenbaseID:XB-GENE-6035542 Length:784 Species:Xenopus tropicalis

Alignment Length:745 Identity:210/746 (28%)
Similarity:346/746 (46%) Gaps:120/746 (16%)


  Fly   459 GNYCNGTDRYPRSRSQQQGHHNAAQQAHHPYQLQHSASTVSH-HPHAHGPPSQGGPGGPGPPHGG 522
            |....|:.|...:.:|.|......::....|:.:.:...:|. .|.....|.:..|..|.||   
 Frog    87 GLQAQGSKRNEYAEAQLQDLFKRMRERTSHYKDKLADPDISSAEPSPTATPVKPKPAPPPPP--- 148

  Fly   523 HPHHPHHGGAGSGGGSGPGSHGGQPHHQKPRRTASQRIRAATAARKLHFVFDPAGRLC------- 580
                             |.....:|..:..::...|    |..|.|.|:    ...||       
 Frog   149 -----------------PPKKEEKPEVKDEKQAEKQ----AEEAEKEHY----CDMLCCKFKRPT 188

  Fly   581 ----------------------YYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSD 623
                                  ..|...|:::|.:|.|:|..|..|.......|..|...||:.|
 Frog   189 LKKSLQKFKLPSSIDAYTDRSYLLWLFFVAVSFNWNCWLIPMRCVFPVQTPNNILYWMISDYICD 253

  Fly   624 FLYLIDI-LFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNSILRSF 687
            .|||||| :|..|..:::.|.:.|:..:.:.:|.:||.|.:|...::|.|.||:..||..:.|:.
 Frog   254 ALYLIDIFIFQPRLQFVKGGDIITERKQTKANYWDSTKFRLDVASVIPFDLLYMVFGFQPVFRAN 318

  Fly   688 RLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHDSE 752
            ||:|...|:.|.||.|.......::|......|||.|.|.|.|:|:......|..|..||| |.:
 Frog   319 RLLKYTSFFEFNDRLEAVMEKAYIYRVIRTTGYLLFILHINACIYYWASSYEGIASTKWVY-DGK 382

  Fly   753 SADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAA 817
            .    ..||:.||:....|.|||.|.:|::..|.||.:|....|:.:|::::|.:.:::.:.:|.
 Frog   383 G----NMYLRCYYFAVRTLITIGGLAEPQTVFEIVFQLLNYFTGVFVFSSLIGQMRDVIGAATAG 443

  Fly   818 RKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHL 882
            :..::|.:|...:||...::|..:|.:|..|::|.|.:|...||...:..:|.|::..|||:|:.
 Frog   444 QSYYRASVDKTVSYMSSNKIPKVVQNRVRTWYEYTWDSQGMLDESELLEEMPTKMQLAIAIDVNF 508

  Fly   883 DTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVA--DNGKTV 945
            ..:.||::|:..::..:.:|:|||:.:::.|||::|:|||:|:||||:.:|.:||:.  ||.| |
 Frog   509 AIVDRVDLFKGCDSQMIQDLLLRLKSIVYLPGDFVCKKGEIGREMYIIKQGAVQVLGGPDNQK-V 572

  Fly   946 MASLKAGSYFGEISILNMGTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVK 1010
            :.:||||:.|||||:|:.| .||||||:|.:.|:::||:|.||.:.::|..||.::..|...|.|
 Frog   573 LVTLKAGAVFGEISLLSAG-GGNRRTANVVAYGFANLFILDKKSLNEILVHYPDSKKLLTKKAKK 636

  Fly  1011 RL-EKYKKA-PLEKVKYFNVVAMGRCQSTPGLVE-----SCGRTSLEEMWLPPATAGASSLMHHH 1068
            .| ||.|.| |....|.|..:...: ..||.|.:     :.|||            |.|.|....
 Frog   637 LLKEKGKPAGPAVVNKGFGHLIPPK-PETPRLFKALMSATSGRT------------GLSLLTRLK 688

  Fly  1069 QALQQQHQ---------ASQQQPHRQES---------TQTSSQ-------THGYSPRSYADRLAR 1108
            ||...:::         .|...|.:|:.         |:.|.:       |.|.:|:..|...::
 Frog   689 QAASNENKEVNKTSDMAKSTDDPAKQKEKSNVQDAKLTEESKEQPAGAHATPGAAPKPDATAGSK 753

  Fly  1109 ATDSPRSVSPSAHGS-------EERPRSRT 1131
            :.....|:||||...       |.|.|.:|
 Frog   754 SKSFIISMSPSAKAGEGELLTVEVRDRKKT 783



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.