DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and cnga1

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_017950934.1 Gene:cnga1 XenbaseID:XB-GENE-950954 Length:708 Species:Xenopus tropicalis

Alignment Length:467 Identity:223/468 (48%)
Similarity:312/468 (67%) Gaps:10/468 (2%)


  Fly   545 GQPHHQKPRRTASQRIRAATAARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINR 609
            |:...:|.:....::    ...:|..||.||:|.|.|.|...::|..:||:.:||.|..|.|:.:
 Frog   148 GKAEKEKEKEKEKEK----EIKKKDIFVIDPSGNLYYNWLFCITMPVMYNWTMIIARACFDELQQ 208

  Fly   610 RTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFL 674
            ..:.:||.|||:||.:|:.|:....||||||.|:|..|.:|||..|..:..|.:|.|.::|.|.|
 Frog   209 DYLELWFFLDYMSDAIYIADMFVRTRTGYLEQGLLVRDEVKLRDKYKMTMQFKLDVLSIIPTDIL 273

  Fly   675 YLSIGFN-SILRSFRLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKN 738
            ||..|.| ..||..:|:::.|.:.|..|||..|||||:||.:.||.|:::|.|||.|:|:.|.|.
 Frog   274 YLQFGLNYPELRLNKLLRVARMFEFFQRTETRTNYPNIFRISNLIMYIVIIIHWNACVYYSISKA 338

  Fly   739 NGFGSRNWVYHDS---ESADVVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLF 800
            .|||...|||.::   |...:.::|:.|.||.||.|||||:.|.|....|:.||:...|.|:::|
 Frog   339 IGFGEDTWVYPNTSHPEYGRLARKYVYSLYWSTLTLTTIGETPPPVQDSEFWFVVADFLVGVLIF 403

  Fly   801 ATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAV 865
            ||::|:|.:::::::|||.|||.::|.:|.||..|:|...|:.:|||||||||..:|..||...:
 Frog   404 ATIVGNVGSMISNMNAARAEFQGRIDAIKQYMHFRKVSKDLEKRVIKWFDYLWTNKKAVDEREVL 468

  Fly   866 SCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIV 930
            ..|||||:|||||||||||||:|.||.:.|||.|.||||:|:|.::||||||||||::|:||||:
 Frog   469 KYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLIELVLKLQPQVYSPGDYICRKGDIGREMYII 533

  Fly   931 NRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDV 993
            ..|:|.||||:|.|....|..|||||||||||:  ..|||||||:::|:||||||.|||.|:.:.
 Frog   534 KEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEA 598

  Fly   994 LKEYPAARVRLE 1005
            |.|||.|:..||
 Frog   599 LTEYPDAKAMLE 610



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.