DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and cnga4

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_017945387.1 Gene:cnga4 XenbaseID:XB-GENE-996762 Length:573 Species:Xenopus tropicalis

Alignment Length:459 Identity:194/460 (42%)
Similarity:301/460 (65%) Gaps:6/460 (1%)


  Fly   565 AARKLHFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLID 629
            :.|....:.||||...|.|..::.:...||:.:||.|..|.|:..:.:.:|..||||.|.||::|
 Frog    40 STRNRSSILDPAGNWYYCWLNIMVLPVTYNWVIIICRSCFPELQYQYLPVWLSLDYLCDVLYVMD 104

  Fly   630 ILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNS-ILRSFRLVKIY 693
            |:.:|.||:||:|:|.||...:..||::|:.|..|.:.:||.||||..:|.:: .:|..|.::.:
 Frog   105 IIANFHTGFLEEGILVTDRHLIARHYISSSKFRWDLISVLPTDFLYFKLGIHTPAVRINRFLRFH 169

  Fly   694 RFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY---HDSESAD 755
            |.:...||||....|||.||...|:.|:.|:.|||.|:|..:....|||...||:   .||:.|.
 Frog   170 RLFESFDRTETRIPYPNAFRICKLMAYIFVVIHWNSCVYFALSSFIGFGKDKWVHPNITDSDFAR 234

  Fly   756 VVKQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKE 820
            :.:|||.|:|:.||.|||:||:|.|..:.|::|:::..|..::.|||::|.:.::|:::::|.:.
 Frog   235 LGRQYLYSFYFSTLILTTVGDIPPPVQEEEWLFMVVDFLIAVLGFATIMGSMTSVVSNMNSADEA 299

  Fly   821 FQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTL 885
            |....|.||.|::|.:|...::.|||.|..:|.:.:|.::|...:..||:||:.|:|::|||..|
 Frog   300 FYPNYDNVKLYLKMYKVNRSVKKKVIAWHQHLQIYKKLTNENDILQNLPEKLRVEVAVSVHLPIL 364

  Fly   886 KRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLK 950
            .:|:||||.|...|.||||:|:|.::|||:|:|:||::|:||||:..|:|.||||:|.|..|.|.
 Frog   365 SKVQIFQNCEKSLLEELVLKLKPQVYSPGEYVCKKGDIGREMYIIKEGKLAVVADDGVTQFAELG 429

  Fly   951 AGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLE 1013
            .|:|||||||||:  .|:||||||:::|:||||||.|||:|:.|.|:|||.|:..||....:.|.
 Frog   430 EGNYFGEISILNIRGNTSGNRRTANIKSIGYSDLFCLSKEDLRDALREYPDAKAILEQKGREILL 494

  Fly  1014 KYKK 1017
            |..|
 Frog   495 KMNK 498



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.870

Return to query results.
Submit another query.