DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG42260 and LOC100334711

Sequence 1:NP_001356969.1 Gene:CG42260 FlyBaseID:FBgn0259145 Length:1269 Species:Drosophila melanogaster
Sequence 2:XP_002660423.1 Gene:LOC100334711 ID: Length:718 Species:Danio rerio

Alignment Length:458 Identity:221/459 (48%)
Similarity:305/459 (66%) Gaps:14/459 (3%)


  Fly   571 FVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFR 635
            ::.|||..|.|:|..:|::...||..:::.|..|.|:......:|..|||.||.:|.:|.....|
Zfish   190 WIMDPATDLYYHWLTIVAIPVFYNLMLLVTRACFNELQDDYTILWMVLDYTSDVIYYLDTFVRSR 254

  Fly   636 TGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYLSIGFNS-ILRSFRLVKIYRFWAFM 699
            ||:||.|:|..::.||..||..|..|..|...::|.|.|.|.:|:|: .||..||.|:.|.:.:.
Zfish   255 TGFLEQGLLVRESKKLWEHYKKSPQFKFDIFSMIPTDILMLKVGYNNPELRFNRLFKMARLFEYF 319

  Fly   700 DRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVY---HDSESADVVKQYL 761
            ||||..||:||:||.:.|:.|:|:|.|||||::..|.|..||||.:|||   .|.|...:.::|:
Zfish   320 DRTETRTNFPNIFRISNLVLYILIIIHWNGCIFFAISKTLGFGSDSWVYPNISDPEFGRLGRKYI 384

  Fly   762 QSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLD 826
            ...||.||.|||||:.|.|....||.||:...|.|:::|||::|:|..::::::|:|.|||||:|
Zfish   385 YCLYWSTLTLTTIGETPPPVRDIEYFFVVSDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKID 449

  Fly   827 GVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIF 891
            .:|.||:.|:|...|:.:|:|||||||..||..||:..:..|||||||||||||||:||::|.||
Zfish   450 SIKQYMQFRKVSKDLEARVVKWFDYLWTEQKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIF 514

  Fly   892 QNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFG 956
            |:.|||.|.||||:|:|.:||||||||:||::|:||||:..|:|.||||:|.|....|..|:|||
Zfish   515 QDCEAGLLVELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFG 579

  Fly   957 EISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRLESIAVKRLEKYKKAP 1019
            |||||.:  ..|||||||::|||||||||.|||.|:.|.|.|||.|:        |.||:..:|.
Zfish   580 EISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMDALSEYPEAK--------KALEEKGRAI 636

  Fly  1020 LEK 1022
            |.|
Zfish   637 LMK 639

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42260NP_001356969.1 None
LOC100334711XP_002660423.1 Ion_trans 228..441 CDD:278921 88/213 (41%)
Crp 507..697 CDD:223736 81/142 (57%)
CAP_ED 513..629 CDD:237999 73/124 (59%)
CLZ 629..699 CDD:293134 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1073751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.