DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp58c and Obp85a

Sequence 1:NP_611710.1 Gene:Obp58c FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001334691.1 Gene:Obp85a FlyBaseID:FBgn0037589 Length:180 Species:Drosophila melanogaster

Alignment Length:180 Identity:34/181 (19%)
Similarity:62/181 (34%) Gaps:41/181 (23%)


  Fly    46 DLIEGCARETNFTLPNQNEEA--LVDITADRAIR-------GTCFGKCVF---SKLNLMKDNNLD 98
            ||...|.:.|..:|...|.|.  .:::.|.|...       ..|..:|.|   ..:.:.....||
  Fly    12 DLSIKCCQLTRPSLDKGNSECRKSLNLPAHRKFNFAELYTINMCIEECNFIGCGYIEIDPPFRLD 76

  Fly    99 MDAVRSLFTERFPD-DPEYAKEMINAFDHC------HGKS--------EENTSMFLSKPLFKQMS 148
            :..:|:......|. ..|....:::|:..|      ||:.        |     |:.:|      
  Fly    77 LANIRTNLQTIAPQPQNESIPFLVDAYRKCELFRSSHGRRFTLHLPDIE-----FIEEP------ 130

  Fly   149 KQFCDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQDSLAT 198
               |:|.:..:..||.......||::.:..:.||.....:..:|...:.|
  Fly   131 ---CNPFALQITICVRIHAMQKCPSEFYVDSDECRLAREYFTQCVGDIET 177

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 21/115 (18%)
Obp85aNP_001334691.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21066
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.