DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp58c and Obp58b

Sequence 1:NP_611710.1 Gene:Obp58c FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_611709.1 Gene:Obp58b FlyBaseID:FBgn0034768 Length:203 Species:Drosophila melanogaster

Alignment Length:199 Identity:103/200 (52%)
Similarity:142/200 (71%) Gaps:6/200 (3%)


  Fly     3 CTIL-LSFFSLIWFAGGIKIDCENTEAINEDHIHYCCKHPDGHNDLIEGCARETNFTLPNQNEEA 66
            |.|: |....|:    .:::.|.:.|.|:|::||:||||.|||:|:.|.||::|||.||:.||||
  Fly     9 CVIISLRLNGLV----AVRVHCRHMERIHEENIHHCCKHQDGHDDVTESCAKQTNFRLPSPNEEA 69

  Fly    67 LVDITADRAIRGTCFGKCVFSKLNLMKDNNLDMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKS 131
            :||:|.|:|:.|||:.||||...|||::|.||||.|||.:......|||||.||:||::.||.:|
  Fly    70 IVDVTVDQAMVGTCWAKCVFDHYNLMENNTLDMDKVRSYYKRYHQTDPEYATEMLNAYEKCHTQS 134

  Fly   132 EENTSMFLSKPLFKQMS-KQFCDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQDS 195
            ||.|..|||.|:.:..| .:||.|.||::::|||..|||||||.|||.|.||.:||||::||:|.
  Fly   135 EEATEKFLSLPIVRAFSTAKFCKPTSSIIMSCVIYNFFHNCPASRWSNTTECVETLAFARKCKDV 199

  Fly   196 LATL 199
            |.|:
  Fly   200 LTTM 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 49/88 (56%)
Obp58bNP_611709.1 PBP_GOBP 52..154 CDD:299791 55/102 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130837141
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21066
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.