DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp58c and Obp47b

Sequence 1:NP_611710.1 Gene:Obp58c FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_610669.1 Gene:Obp47b FlyBaseID:FBgn0033614 Length:199 Species:Drosophila melanogaster

Alignment Length:183 Identity:49/184 (27%)
Similarity:82/184 (45%) Gaps:16/184 (9%)


  Fly    17 GGIKIDCENTEAINEDHIHYCCKHPDGHNDLI-EGCARETNFTLPNQNEEALVDITADRAIRGTC 80
            |...|||:....:.:..:  |||  ||..|.: |.||:....|...|  :|....:.|.|   .|
  Fly    22 GQATIDCQRPPQLVDPAL--CCK--DGGRDQVAEQCAQRILGTANGQ--KAGGPPSLDTA---AC 77

  Fly    81 FGKCVFSKLNLMKD-NNLDMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLF 144
            ..:|:.:....:.: ..|::..:||..:.:|.:|..|.:.|..||..|..:|:...:|.:.:...
  Fly    78 LAECILTSSKYIDEPQKLNLANIRSDLSAKFSNDTLYVETMTMAFSKCEPQSQRRLAMIMQQQQQ 142

  Fly   145 KQMSK-----QFCDPKSSVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKC 192
            .|..|     ..|.|.|::||.|...::|.|||..||:...:|....|:..:|
  Fly   143 VQQQKTQQQQPRCSPFSAIVLGCTYMEYFKNCPDHRWTPNAQCTLAKAYVTQC 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 21/90 (23%)
Obp47bNP_610669.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130837219
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21066
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.