powered by:
Protein Alignment Obp58c and Obp50d
DIOPT Version :9
| Sequence 1: | NP_611710.1 |
Gene: | Obp58c / 37608 |
FlyBaseID: | FBgn0034769 |
Length: | 199 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_725388.2 |
Gene: | Obp50d / 246436 |
FlyBaseID: | FBgn0050074 |
Length: | 173 |
Species: | Drosophila melanogaster |
| Alignment Length: | 168 |
Identity: | 37/168 - (22%) |
| Similarity: | 63/168 - (37%) |
Gaps: | 27/168 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 CCKHPDGHNDLIEGCARETNFTLPNQNEEALVDITADRAIRGT----CFGKCVFSKLNLMKDNNL 97
|.:.|| ...:..|.: |||.:..:.....:...:.|. |..:|:|...|.:...:|
Fly 22 CSQRPD--VTALRNCCK-----LPNLDFSSFNSKCSQYLVNGVHISPCSFECIFRAANALNGTHL 79
Fly 98 DMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLFKQMSKQ------FCDPKS 156
.|:.:..:.......| |:....::.|..| |..| |.|.|.|.:: .|...:
Fly 80 VMENIEKMMKTILGSD-EFVHVYLDGFRSC-GNQE--------KVLIKAMKRRRVPITGKCGSMA 134
Fly 157 SVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQD 194
.:...|..|..:.|||...|||:..|.:...:|.:|.|
Fly 135 IMYGLCAHRYVYRNCPESVWSKSATCNEAREYSIRCDD 172
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Obp58c | NP_611710.1 |
PBP_GOBP |
47..135 |
CDD:299791 |
17/91 (19%) |
| Obp50d | NP_725388.2 |
None |
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45472881 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR21066 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.940 |
|
Return to query results.
Submit another query.