DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp58c and Obp50d

Sequence 1:NP_611710.1 Gene:Obp58c FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_725388.2 Gene:Obp50d FlyBaseID:FBgn0050074 Length:173 Species:Drosophila melanogaster

Alignment Length:168 Identity:37/169 (22%)
Similarity:63/169 (37%) Gaps:27/169 (16%)


  Fly    37 CCKHPDGHNDLIEGCARETNFTLPNQNEEALVDITADRAIRGT----CFGKCVFSKLNLMKDNNL 97
            |.:.||  ...:..|.:     |||.:..:.....:...:.|.    |..:|:|...|.:...:|
  Fly    22 CSQRPD--VTALRNCCK-----LPNLDFSSFNSKCSQYLVNGVHISPCSFECIFRAANALNGTHL 79

  Fly    98 DMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSKPLFKQMSKQ------FCDPKS 156
            .|:.:..:.......| |:....::.|..| |..|        |.|.|.|.::      .|...:
  Fly    80 VMENIEKMMKTILGSD-EFVHVYLDGFRSC-GNQE--------KVLIKAMKRRRVPITGKCGSMA 134

  Fly   157 SVVLACVIRQFFHNCPADRWSKTKECEDTLAFSKKCQD 194
            .:...|..|..:.|||...|||:..|.:...:|.:|.|
  Fly   135 IMYGLCAHRYVYRNCPESVWSKSATCNEAREYSIRCDD 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 17/92 (18%)
Obp50dNP_725388.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130837373
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21066
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.