DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp58c and Obp50c

Sequence 1:NP_611710.1 Gene:Obp58c FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_725387.3 Gene:Obp50c FlyBaseID:FBgn0050072 Length:185 Species:Drosophila melanogaster

Alignment Length:182 Identity:47/183 (26%)
Similarity:73/183 (40%) Gaps:24/183 (13%)


  Fly     5 ILLSFFSLIWFAG--GIKIDCENTEAINEDHIHYCCKHPDGHNDLIEG-CARETNFTLPNQNEEA 66
            |.|...||:..||  .|.:||...:..|  .:..||.:|....|..:. |.:             
  Fly     5 IALLICSLLAMAGCDPIDVDCTRRQDFN--IVKDCCVYPTFRFDQFKSQCGK------------- 54

  Fly    67 LVDITADRAIRGTCFGKCVFSKLNLMKDNNLDMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKS 131
            .:.:.|.|.  ..|..:|:|:|.|.:.|..:..|..| |..|:...:.::.:...|....|....
  Fly    55 YMPVGAPRI--SPCLYECIFNKTNTVVDGAIHPDNAR-LMLEKLFGNQDFEEAYFNGLMGCSDSV 116

  Fly   132 EENTSMFLSKPLFKQMSKQFCDPKSSVVLACVIRQFFHNCPADRWSKTKECE 183
            :|..|...|:|   |...:.|.|.|.....|..|..|::||:..||.|:.||
  Fly   117 QEMISNRRSRP---QRKTEQCSPFSLFYGICAQRYVFNHCPSSSWSGTESCE 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 16/89 (18%)
Obp50cNP_725387.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21066
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.