DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Obp58c and Obp50a

Sequence 1:NP_611710.1 Gene:Obp58c FlyBaseID:FBgn0034769 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_995832.1 Gene:Obp50a FlyBaseID:FBgn0050067 Length:200 Species:Drosophila melanogaster

Alignment Length:175 Identity:38/176 (22%)
Similarity:72/176 (41%) Gaps:34/176 (19%)


  Fly    33 HIHYCCKHP---------DGHNDLIEGCARETNFTLPNQNEEALVDITADRAIRGTCFGKCVFSK 88
            ::|.||..|         :.|...|:....      .|:..::.|:: |:..|:  |...|.|:.
  Fly    33 NVHVCCSAPLPNWGVFNRECHKSAIQASVS------INRISKSKVNL-ANFLIK--CRLDCDFNA 88

  Fly    89 LNLMKDNNLDMDAVRSLFTERFPDDPEYAKEMINAFDHCHGKSEENTSMFLSK-----PLFKQMS 148
            .::::.|.|....||.:....|.::|     .|:|::....|.   :::..||     ||.:|  
  Fly    89 SSVLQGNRLIQAKVRPMLERAFSNEP-----TIDAYESNFAKC---STVVRSKYQELSPLSRQ-- 143

  Fly   149 KQFCDPKSSVVLACVIRQFFHNCPADRWSK-TKECEDTLAFSKKC 192
            ...||..:.....|...:....||...|.: .:.|::..|::|||
  Fly   144 SDACDRHALFYSLCAYARLIFTCPDKMWQRNNRMCQEAKAYAKKC 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Obp58cNP_611710.1 PBP_GOBP 47..135 CDD:299791 17/88 (19%)
Obp50aNP_995832.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130837519
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21066
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.