DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and SKP2B

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001185415.1 Gene:SKP2B / 844036 AraportID:AT1G77000 Length:360 Species:Arabidopsis thaliana


Alignment Length:403 Identity:104/403 - (25%)
Similarity:161/403 - (39%) Gaps:114/403 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 VEGTHIS---NLFPELLEQIFEHLPVRDLGRAAQVCTAWRDAAYAKSVWKGVEAKLHLKRSSPSL 205
            :||..||   ::..|||.:|...:..|.:..|:.:|:.||||                       
plant    20 MEGVLISEWKDIPVELLMKILNLVDDRTVIIASCICSGWRDA----------------------- 61

  Fly   206 FNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLGHAFSVDLPNLKTLDLSL 270
                |..|:.::.:...::::..|||                       :.:.....|:||.|..
plant    62 ----VSLGLTRLSLSWCKKNMNSLVL-----------------------SLAPKFVKLQTLVLRQ 99

  Fly   271 CK-QITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLKKLKHLNLRSCWHISDQGIGHL 334
            .| |:.|.::..||.|...|:.|:|.....||:..|..:|.|...|..|||..|...||..:.||
plant   100 DKPQLEDNAVEAIANHCHELQDLDLSKSSKITDHSLYSLARGCTNLTKLNLSGCTSFSDTALAHL 164

  Fly   335 AGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFCV-SVTDSGLKHLA-RMP 397
            ..|.|:                                 ||.:||..|| :|:|:.|:.:. ...
plant   165 TRFCRK---------------------------------LKILNLCGCVEAVSDNTLQAIGENCN 196

  Fly   398 KLEQLNLRSCDNISDIGMAYLTEGGSGINSLDVSFCDKISDQALTHIAQGLYRLRSLSLNQCQ-I 461
            :|:.|||..|:||||.|:..|..|...:.:||:..|..|:|:::..:|.....||||.|..|: |
plant   197 QLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESVVALANRCIHLRSLGLYYCRNI 261

  Fly   462 TDHGMLKIA----KALHE--------------LENLNIGQCSRITDKGLQTLAEDLTNLKT---- 504
            ||..|..:|    |..||              |.:|||.||:.:|...:|.:.:....|.|    
plant   262 TDRAMYSLAQSGVKNKHEMWRAVKKGKFDEEGLRSLNISQCTYLTPSAVQAVCDTFPALHTCSGR 326

  Fly   505 --IDLYGCTQLSS 515
              :.:.||..|.|
plant   327 HSLVMSGCLNLQS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 13/43 (30%)
AMN1 <226..>334 CDD:187754 28/108 (26%)
leucine-rich repeat 236..256 CDD:275381 0/19 (0%)
leucine-rich repeat 263..288 CDD:275381 10/25 (40%)
leucine-rich repeat 289..314 CDD:275381 8/24 (33%)
leucine-rich repeat 315..347 CDD:275381 11/31 (35%)
AMN1 347..524 CDD:187754 55/196 (28%)
leucine-rich repeat 348..373 CDD:275381 0/24 (0%)
leucine-rich repeat 374..398 CDD:275381 9/25 (36%)
leucine-rich repeat 399..424 CDD:275381 12/24 (50%)
leucine-rich repeat 425..450 CDD:275381 6/24 (25%)
leucine-rich repeat 451..475 CDD:275381 12/28 (43%)
leucine-rich repeat 476..501 CDD:275381 8/24 (33%)
SKP2BNP_001185415.1 F-box 28..63 CDD:395521 11/61 (18%)
leucine-rich repeat 66..91 CDD:275381 3/47 (6%)
leucine-rich repeat 92..118 CDD:275381 10/25 (40%)
AMN1 <115..264 CDD:187754 55/181 (30%)
leucine-rich repeat 119..144 CDD:275381 8/24 (33%)
leucine-rich repeat 145..170 CDD:275381 10/24 (42%)
leucine-rich repeat 171..197 CDD:275381 9/25 (36%)
leucine-rich repeat 198..223 CDD:275381 12/24 (50%)
leucine-rich repeat 224..249 CDD:275381 6/24 (25%)
leucine-rich repeat 250..272 CDD:275381 11/21 (52%)
leucine-rich repeat 294..319 CDD:275381 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.