DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and RPP1

DIOPT Version :9

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_001326420.1 Gene:RPP1 / 823573 AraportID:AT3G44480 Length:1240 Species:Arabidopsis thaliana


Alignment Length:447 Identity:111/447 - (24%)
Similarity:185/447 - (41%) Gaps:103/447 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GTHIS--------NLFPELLEQI--FEHLPVRDLGRAAQVCTAWRDAAY----AKSV-WKGVEAK 195
            |.|:.        |:..::||::  |..:.:....:..::..|.:|..|    .:|: |.|.|: 
plant   618 GIHLELSNTEEELNISEKVLERVHDFHFVRIDASFQPERLQLALQDLIYHSPKIRSLNWYGYES- 681

  Fly   196 LHLKRSSPSLFN--CLVKRGIKKVQILSLRRS-LKDLVLGVPALTSL---------------NLS 242
            |.|    ||.||  .||:        |.:|.| |:.|..|...|.:|               |||
plant   682 LCL----PSTFNPEFLVE--------LDMRSSNLRKLWEGTKQLRNLKWMDLSYSSYLKELPNLS 734

  Fly   243 GCFNVADMNLGHAFS-VDLP-------NLKTLDLSLCKQITDTSLGRI--AQHLRNLETLELGGC 297
            ...|:.::.|.:..| |:||       :|:.|||..|     :||.::  .::...|..|:|..|
plant   735 TATNLEELKLRNCSSLVELPSSIEKLTSLQILDLENC-----SSLEKLPAIENATKLRELKLQNC 794

  Fly   298 CNITNTGLLLIAWGLKKLKHLNLRSC----------WHISDQGIGHLAGFSR----ETAEGNLQ- 347
            .::..  |.|.......||.||:..|          ..|:|..:..|:..|.    .::.|||| 
plant   795 SSLIE--LPLSIGTATNLKQLNISGCSSLVKLPSSIGDITDLEVFDLSNCSSLVTLPSSIGNLQN 857

  Fly   348 LEYLGLQDCQRLSDEALGHIAQGLTSLKSINLSFC--------VSVTDSGLKHLARMPKLEQLNL 404
            |..|.::.|.:|  ||| .|...|.||.::||:.|        :|...|.|:......|...|::
plant   858 LCKLIMRGCSKL--EAL-PININLKSLDTLNLTDCSQLKSFPEISTHISELRLKGTAIKEVPLSI 919

  Fly   405 RSCDNISDIGMAYLTEGGSGINSLDVSFCDKISD--QALTHIAQGLYRLRSLSLNQCQITDHGML 467
            .|...::|..::|........::.|:.....:|.  |.:....:.:.|||.||||.|    :.::
plant   920 MSWSPLADFQISYFESLMEFPHAFDIITKLHLSKDIQEVPPWVKRMSRLRDLSLNNC----NNLV 980

  Fly   468 KIAKALHELENLNIGQCSRITDKGLQTLAEDLTNLKTIDLY--GCTQLSSKGIDIIM 522
            .:.:....|:.:....|     |.|:.| :...|...|.||  .|.:|:.:..|:||
plant   981 SLPQLSDSLDYIYADNC-----KSLERL-DCCFNNPEIRLYFPKCFKLNQEARDLIM 1031

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box-like 149..190 CDD:289689 8/55 (15%)
AMN1 <226..>334 CDD:187754 34/142 (24%)
leucine-rich repeat 236..256 CDD:275381 7/34 (21%)
leucine-rich repeat 263..288 CDD:275381 7/26 (27%)
leucine-rich repeat 289..314 CDD:275381 6/24 (25%)
leucine-rich repeat 315..347 CDD:275381 11/45 (24%)
AMN1 347..524 CDD:187754 48/189 (25%)
leucine-rich repeat 348..373 CDD:275381 9/24 (38%)
leucine-rich repeat 374..398 CDD:275381 7/31 (23%)
leucine-rich repeat 399..424 CDD:275381 4/24 (17%)
leucine-rich repeat 425..450 CDD:275381 3/26 (12%)
leucine-rich repeat 451..475 CDD:275381 7/23 (30%)
leucine-rich repeat 476..501 CDD:275381 5/24 (21%)
RPP1NP_001326420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.