DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppa and CG15056

DIOPT Version :10

Sequence 1:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster
Sequence 2:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster


Alignment Length:292 Identity:60/292 - (20%)
Similarity:120/292 - (41%) Gaps:80/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 LKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDCQRLSDEALGHIAQGL-TSLKSIN 378
            |.:::||.| .::|:   :|.|:...|     .||.|.|    |.:|...|.....| |||.|:.
  Fly   133 LTYVSLRRC-QLNDE---NLVGWEFLT-----HLETLDL----RYNDRLTGSCLMSLPTSLLSLY 184

  Fly   379 LSFCVSVTDSGLKHLARMPKLEQLNLRSCDNISDIGMAYLTEGGSG------------INSLDVS 431
            ::.|.::..:.|..|.|:|:|.:  ||:.|         |..||..            :..:::|
  Fly   185 ITGCRNLCPNQLIFLNRIPRLRE--LRASD---------LMPGGHWHIYRDLVLACPLLVMVEIS 238

  Fly   432 FCDKISDQ----ALTHIAQGLYRLRSLSLNQCQITDHGMLKIAKALHELENLNIGQCSR--ITDK 490
            .|....|:    .|.::...:.:..|....:|:::|..::.:.. :..|.||.......  ::..
  Fly   239 ICSLNRDEYRLGELRYLQSLVIKAHSTDTIRCKVSDWMLISLLD-VPFLRNLMFSDAPSGFVSAN 302

  Fly   491 GLQTLA-----------------------EDLTNLKTIDLYGCTQLSSK-GIDIIMKLPKLQKLN 531
            .|..::                       .:||.|:|:||.....:::: .|::::.:|     |
  Fly   303 ALSIISRFRQLRVLKMPNQPYRPNDLLRLRNLTFLETLDLSNSPYITNEVVIELVIGIP-----N 362

  Fly   532 LGLWLVRXC------VHHDCNACAAKEAARGS 557
            |.:.:|: |      |:.|.. .|:|:.:.|:
  Fly   363 LSVLIVQGCPLLTNRVYLDAE-LASKKRSNGN 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpaNP_001261138.1 F-box_FBXL14 150..190 CDD:438897
AMN1 <226..>334 CDD:187754 5/18 (28%)
leucine-rich repeat 236..256 CDD:275381
leucine-rich repeat 263..288 CDD:275381
leucine-rich repeat 289..314 CDD:275381
leucine-rich repeat 315..347 CDD:275381 8/31 (26%)
AMN1 347..524 CDD:187754 42/219 (19%)
leucine-rich repeat 348..373 CDD:275381 8/25 (32%)
leucine-rich repeat 374..398 CDD:275381 6/23 (26%)
leucine-rich repeat 399..424 CDD:275381 7/24 (29%)
leucine-rich repeat 425..450 CDD:275381 4/28 (14%)
leucine-rich repeat 451..475 CDD:275381 3/23 (13%)
leucine-rich repeat 476..501 CDD:275381 5/49 (10%)
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 8/31 (26%)
leucine-rich repeat 157..179 CDD:275381 8/25 (32%)
leucine-rich repeat 180..204 CDD:275381 6/23 (26%)
leucine-rich repeat 205..231 CDD:275381 7/36 (19%)
leucine-rich repeat 232..285 CDD:275381 7/53 (13%)
leucine-rich repeat 286..326 CDD:275381 4/39 (10%)
AMN1 306..>376 CDD:187754 12/74 (16%)
leucine-rich repeat 337..362 CDD:275381 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.