DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RYBP and yaf2

Sequence 1:NP_001286742.1 Gene:RYBP FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_017210591.1 Gene:yaf2 ZFINID:ZDB-GENE-041210-115 Length:184 Species:Danio rerio

Alignment Length:148 Identity:75/149 (50%)
Similarity:93/149 (62%) Gaps:14/149 (9%)


  Fly    12 KRQAK-VIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQAATLPGASVNMP 75
            ||||| ..::.:|||||||::|:||||||.||||||||||||||..|.||:|| .|...||..:|
Zfish    13 KRQAKPSSDDGYWDCSVCTFKNTAEAFKCMMCDVRKGTSTRKPRPVSQLVSQQ-VTQQFASATLP 76

  Fly    76 NGKSASGSRHGSGHDRQ------RHKRYPARLKNVDRSTAQTREVTVNSVTVFITEY--KAKPVS 132
            . |..........::|:      .||:...||||||||:||..||||..:||.||:|  |.||.|
Zfish    77 K-KEKKEKTEKDKNEREPTLKKNNHKKMRPRLKNVDRSSAQHLEVTVGDLTVIITDYKEKTKPSS 140

  Fly   133 SRRESSEQSFSESNDSRS 150
            |   ||..:.|..:.|:|
Zfish   141 S---SSSSATSADHHSQS 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 16/23 (70%)
RanBP2-type Zn finger 23..42 CDD:275377 15/19 (79%)
yaf2XP_017210591.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C14842147
eggNOG 1 0.900 E1_KOG4477
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4203
Inparanoid 1 1.050 145 1.000 Inparanoid score I4337
OMA 1 1.010
OrthoDB 1 1.010 D1634090at2759
OrthoFinder 1 1.000 FOG0002361
OrthoInspector 1 1.000 T1054608
orthoMCL 1 0.900 OOG5_134714
Panther 1 1.100 LDO PTHR12920
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5806
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.