DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RYBP and Yaf2

Sequence 1:NP_001286742.1 Gene:RYBP FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001128343.1 Gene:Yaf2 RGDID:1582851 Length:180 Species:Rattus norvegicus

Alignment Length:157 Identity:75/158 (47%)
Similarity:91/158 (58%) Gaps:9/158 (6%)


  Fly     1 MDKKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQAA 65
            |..|.||.|.:::.....:|.:|||||||:|||||||||.||||||||||||||..|.|||||..
  Rat     1 MGDKKSPTRPKRQPKPASDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVT 65

  Fly    66 ---TLPGASVNMPNGK-SASGSRHGSGHDRQRHKRYPARLKNVDRSTAQTREVTVNSVTVFITEY 126
               ..|..|......| ....|...:...:..|||...||||||||:||..||||..:||.||::
  Rat    66 QQFVPPTQSKKEKKDKVEKDKSEKEAASKKNCHKRTRPRLKNVDRSSAQHLEVTVGDLTVIITDF 130

  Fly   127 KAK----PVSSRRESSEQSFSE-SNDS 148
            |.|    |.|....:.:.|.|. |:|:
  Rat   131 KEKAKSAPASGAAAADQHSQSSCSSDT 157

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 19/23 (83%)
RanBP2-type Zn finger 23..42 CDD:275377 17/19 (89%)
Yaf2NP_001128343.1 zf-RanBP 20..43 CDD:279035 19/23 (83%)
RanBP2-type Zn finger 23..42 CDD:275376 17/19 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C14841484
eggNOG 1 0.900 E1_KOG4477
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4203
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1634090at2759
OrthoFinder 1 1.000 FOG0002361
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12920
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.910

Return to query results.
Submit another query.