DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RYBP and rybp

Sequence 1:NP_001286742.1 Gene:RYBP FlyBaseID:FBgn0034763 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001016846.1 Gene:rybp XenbaseID:XB-GENE-992066 Length:338 Species:Xenopus tropicalis

Alignment Length:306 Identity:80/307 (26%)
Similarity:101/307 (33%) Gaps:157/307 (51%)


  Fly     1 MDKKSSPVRRQKRQAK-VIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSALVAQQA 64
            |..|.||. |.||||| ..:|.:|||||||::||||||||.:|||||||||||||:||.|||||.
 Frog     3 MGDKKSPT-RPKRQAKPSADEGYWDCSVCTFKNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQV 66

  Fly    65 ATLPGA----------SVNMPNGKSASGSR----------------------------------- 84
            |....:          .|..|..:.....:                                   
 Frog    67 AQQYASPPPPKKEKKEKVEKPEKERTDREKLEKEKPEKDKLDREKLDREKLDREKLDREKLDREK 131

  Fly    85 ---------------------------------------------------------HGSGHDRQ 92
                                                                     .....||:
 Frog   132 LDREKLDKEKLDRDKIDREKLDREKNDREKLEREKLDREKLDREKPEKEKPEKEKPEKEQKTDRE 196

  Fly    93 RHK------------------------------RYPA-----------------------RLKNV 104
            ||:                              |.|:                       ||||:
 Frog   197 RHEKDKEKTERDINSSVVKKTANKKTRPKPDILRNPSVDASIQSGNPNTKISNFNHTSRPRLKNI 261

  Fly   105 DRSTAQTREVTVNSVTVFITEYKAKPVSSRRESSEQSFSESNDSRS 150
            ||||||...|||.:|||.||::|.|..||...||..:.|..::.::
 Frog   262 DRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQN 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RYBPNP_001286742.1 zf-RanBP 20..43 CDD:279035 17/23 (74%)
RanBP2-type Zn finger 23..42 CDD:275377 15/19 (79%)
rybpNP_001016846.1 zf-RanBP 22..45 CDD:279035 17/23 (74%)
RanBP2-type Zn finger 25..44 CDD:275376 15/19 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4477
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4234
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1634090at2759
OrthoFinder 1 1.000 FOG0002361
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5806
TreeFam 1 0.960
87.860

Return to query results.
Submit another query.